KEGG   Homo sapiens (human): 10362
Entry
10362             CDS       T01001                                 

Gene name
HMG20B, BRAF25, BRAF35, HMGX2, HMGXB2, PP7706, SMARCE1r, SOXL, pp8857
Definition
(RefSeq) high mobility group 20B
  KO
K24650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10362 (HMG20B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    BRAF-HDAC complex
     10362 (HMG20B)
SSDB
Motif
Pfam: HMG_box HMG_box_2 DASH_Duo1 LMBR1
Other DBs
NCBI-GeneID: 10362
NCBI-ProteinID: NP_006330
OMIM: 605535
HGNC: 5002
Ensembl: ENSG00000064961
Vega: OTTHUMG00000150437
Pharos: Q9P0W2(Tbio)
UniProt: Q9P0W2
Position
19p13.3
AA seq 317 aa
MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELAL
EERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHEK
LIVRIKEILAQVASEHL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtcccacggccccaagcagcccggcgcggccgccgcgccggcgggcggcaaggctccg
ggccagcatgggggcttcgtggtgactgtcaagcaagagcgcggcgagggtccacgcgcg
ggcgagaaggggtcccacgaggaggagccggtgaagaaacgcggctggcccaagggcaag
aagcggaagaagattctgccgaatgggcccaaggcaccggtcacgggctacgtgcgcttc
ctgaacgagcggcgcgagcagatccgcacgcgccacccggatctgccctttcccgagatc
accaagatgctgggcgccgagtggagcaagctgcagccaacggaaaagcagcggtacctg
gatgaggccgagagagagaagcagcagtacatgaaggagctgcgggcgtaccagcagtct
gaagcctataagatgtgcacggagaagatccaggagaagaagatcaagaaagaagactcg
agctctgggctcatgaacactctcctgaatggacacaagggtggggactgcgatggcttc
tccaccttcgatgttcccatcttcactgaagagttcttggaccaaaacaaagcgcgtgag
gcggagcttcggcgcttgcggaagatgaatgtggccttcgaggagcagaacgcggtactg
cagaggcacacgcagagcatgagcagcgcgcgcgagcgtctggagcaggagctggcgctg
gaggagcggaggacgctggcgctgcagcagcagctccaggccgtgcgccaggcgctcacc
gccagcttcgcctcactgccggtgccgggcacgggcgaaacgcccacgctgggcactctg
gacttctacatggcccggcttcacggagccatcgagcgcgaccccgcccagcacgagaag
ctcatcgtccgcatcaaggaaatcctggcccaggtcgccagcgagcacctgtga

DBGET integrated database retrieval system