KEGG   Homo sapiens (human): 10379Help
Entry
10379             CDS       T01001                                 

Gene name
IRF9, IRF-9, ISGF3, ISGF3G, p48
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06122  IFN signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    10379 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    10379 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10379 (IRF9)
   04625 C-type lectin receptor signaling pathway
    10379 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10379 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    10379 (IRF9)
  09172 Infectious disease: viral
   05162 Measles
    10379 (IRF9)
   05164 Influenza A
    10379 (IRF9)
   05160 Hepatitis C
    10379 (IRF9)
   05168 Herpes simplex virus 1 infection
    10379 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    10379 (IRF9)
   05169 Epstein-Barr virus infection
    10379 (IRF9)
   05165 Human papillomavirus infection
    10379 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10379 (IRF9)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    10379 (IRF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF-3 IRF
Motif
Other DBs
NCBI-GeneID: 10379
NCBI-ProteinID: NP_006075
OMIM: 147574
HGNC: 6131
Ensembl: ENSG00000213928
Vega: OTTHUMG00000028799
Pharos: Q00978(Tbio)
UniProt: Q00978
Position
14q12
AA seq 393 aa AA seqDB search
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIV
SGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLD
CRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISW
NAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSH
TPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaggcagggcacgctgcacccgaaaactccggaactgggtggtggagcaagtg
gagagtgggcagtttcccggagtgtgctgggatgatacagctaagaccatgttccggatt
ccctggaaacatgcaggcaagcaggacttccgggaggaccaggatgctgccttcttcaag
gcctgggcaatatttaagggaaagtataaggagggggacacaggaggtccagctgtctgg
aagactcgcctgcgctgtgcactcaacaagagttctgaatttaaggaggttcctgagagg
ggccgcatggatgttgctgagccctacaaggtgtatcagttgctgccaccaggaatcgtc
tctggccagccagggactcagaaagtaccatcaaagcgacagcacagttctgtgtcctct
gagaggaaggaggaagaggatgccatgcagaactgcacactcagtccctctgtgctccag
gactccctcaataatgaggaggagggggccagtgggggagcagtccattcagacattggg
agcagcagcagcagcagcagccctgagccacaggaagttacagacacaactgaggccccc
tttcaaggggatcagaggtccctggagtttctgcttcctccagagccagactactcactg
ctgctcaccttcatctacaacgggcgcgtggtgggcgaggcccaggtgcaaagcctggat
tgccgccttgtggctgagccctcaggctctgagagcagcatggagcaggtgctgttcccc
aagcctggcccactggagcccacgcagcgcctgctgagccagcttgagaggggcatccta
gtggccagcaacccccgaggcctcttcgtgcagcgcctttgccccatccccatctcctgg
aatgcaccccaggctccacctgggccaggcccgcatctgctgcccagcaacgagtgcgtg
gagctcttcagaaccgcctacttctgcagagacttggtcaggtactttcagggcctgggc
cccccaccgaagttccaggtaacactgaatttctgggaagagagccatggctccagccat
actccacagaatcttatcacagtgaagatggagcaggcctttgcccgatacttgctggag
cagactccagagcagcaggcagccattctgtccctggtgtag

DBGET integrated database retrieval system