KEGG   Homo sapiens (human): 10380
Entry
10380             CDS       T01001                                 
Symbol
BPNT1, HEL20, PIP
Name
(RefSeq) 3'(2'), 5'-bisphosphate nucleotidase 1
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00920  Sulfur metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    10380 (BPNT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    10380 (BPNT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     10380 (BPNT1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    10380 (BPNT1)
SSDB
Motif
Pfam: Inositol_P DUF2788
Other DBs
NCBI-GeneID: 10380
NCBI-ProteinID: NP_006076
OMIM: 604053
HGNC: 1096
Ensembl: ENSG00000162813
Pharos: O95861(Tbio)
UniProt: O95861 V9HWF9
Structure
Position
1:complement(220057482..220089788)
AA seq 308 aa
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICS
SLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPE
SIKNALVP
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcttccagtaacactgtgttgatgcggttggtagcctccgcatattctattgctcaa
aaggcaggaatgatagtcagacgtgttattgctgaaggagacctgggtattgtggagaag
acctgtgcaacagacctgcagaccaaagctgaccgattggcacagatgagcatatgttct
tcattggcccggaaattccccaaactcacaattataggggaagaggatctgccttctgag
gaagtggatcaagagctgattgaagacagtcagtgggaagaaatactgaagcaaccatgc
ccatcgcagtacagtgctattaaagaagaagatctcgtggtctgggttgatcctctggat
ggaaccaaggaatataccgaaggtcttcttgacaatgtaacagttcttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactatgaggcagga
ccagatgctgtgttggggaggacaatctggggagttttaggtttaggcgcctttgggttt
cagctgaaagaagtccctgctgggaaacacattatcacaactactcgatcccatagcaac
aagttggttactgactgtgttgctgctatgaaccccgatgctgtgctgcgagtaggagga
gcaggaaataagattattcagctgattgaaggcaaagcctctgcttatgtatttgcaagt
cctggttgtaagaagtgggatacttgtgctccagaagttattttacatgctgtgggaggc
aagttaaccgatatccatgggaatgttcttcagtaccacaaggatgtgaagcatatgaac
tctgcaggagtcctggccacactgaggaattatgactactatgcaagccgagttccagaa
tctattaaaaatgcacttgttccttaa

DBGET integrated database retrieval system