KEGG   Homo sapiens (human): 10382Help
Entry
10382             CDS       T01001                                 

Gene name
TUBB4A, DYT4, TUBB4, beta-5
Definition
(RefSeq) tubulin beta 4A class IVa
  KO
K07375  tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04540  Gap junction
hsa05130  Pathogenic Escherichia coli infection
Disease
H00679  Hypomyelinating leukodystrophy
Drug target
Batabulin (DG01412): D03059 D06560
Brentuximab vedotin: D09587
Cabazitaxel (DG00695): D09755 D10452
Cevipabulin (DG01413): D06576 D08889
Colchicine: D00570
Denintuzumab mafodotin: D11232
Docetaxel (DG00694): D02165 D07866
Eribulin: D08914
Estramustine (DG00724): D02398 D04066 D06397
Glembatumumab vedotin: D09912
Indibulin: D10013
Ixabepilone: D04645
Lexibulin: D10073
Lifastuzumab vedotin: D11238
Maytansine: D04864
Mivobulin isethionate: D05062
Paclitaxel: D00491
Paclitaxel poliglumex: D05333
Podophyllotoxin: D05529
Soblidotin: D01919
Taltobulin: D06001
Tasidotin hydrochloride: D06009
Trastuzumab emtansine: D09980
Verubulin (DG01411): D10029 D10030
Vinblastine (DG00689): D01068 D08675
Vincristine (DG00690): D02197 D08679
Vindesine (DG00691): D01769 D06304
Vinepidine sulfate: D06305
Vinflunine: D09032
Vinglycinate sulfate: D06306
Vinleurosine sulfate: D06307
Vinorelbine (DG00692): D01935 D08680
Vinrosidine sulfate: D06308
Vinzolidine sulfate: D06309
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10382 (TUBB4A)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    10382 (TUBB4A)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    10382 (TUBB4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10382 (TUBB4A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10382 (TUBB4A)
   04147 Exosome [BR:hsa04147]
    10382 (TUBB4A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     10382 (TUBB4A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    10382 (TUBB4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10382 (TUBB4A)
  Exosomal proteins of colorectal cancer cells
   10382 (TUBB4A)
  Exosomal proteins of bladder cancer cells
   10382 (TUBB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 10382
NCBI-ProteinID: NP_001276058
OMIM: 602662
HGNC: 20774
Ensembl: ENSG00000104833
Vega: OTTHUMG00000181829
Pharos: P04350(Tclin)
UniProt: P04350
Position
19p13.3
AA seq 444 aa AA seqDB search
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagatcgtgcacctgcaggccggccagtgcggcaaccagatcggggccaagttt
tgggaggttatcagtgacgaacatggcatcgaccccacaggcacataccatggggacagt
gacctgcaactggagaggatcaacgtgtactacaacgaggccacaggaggaaattatgtc
cccagagcggtgctggtggacctggaacccggcaccatggactctgtccgttctggcccc
ttcggtcagatctttcggccggacaacttcgtgtttggccaatccggagccggcaacaac
tgggcaaaggggcactacacggagggcgcagagctggtggacgctgtcctggacgtagtc
cggaaggaggccgagagctgcgactgccttcagggcttccagctgacccactcgctgggg
ggtggcacggggtccggaatgggcacgctgctcatcagtaagatccgcgaggagttccca
gaccgcatcatgaacaccttcagcgtggtgccctcgcccaaagtgtcagacacggtggtg
gagccctacaacgccacgctgtctgtgcaccagctggtggagaatacggatgagacctac
tgcatcgacaacgaggcactctacgacatctgtttccgcaccctcaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgccgacctgcgcaagctggccgtcaacatggttcccttt
cctcgcctgcacttcttcatgcccggcttcgcacccctgaccagccggggcagccagcag
taccgggccctgacggtgcccgagctcacccagcagatgttcgatgccaagaacatgatg
gcggcgtgcgacccgcgccacggccgctacctgaccgtggccgccgtgttccggggccgc
atgtccatgaaggaggtggacgagcagatgctgagcgtgcagagcaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatggccgcgaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcttgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaatgacctggtatct
gagtaccagcagtaccaggacgccacggccgaggagggcgagttcgaggaggaggcggag
gaggaggtggcctag

DBGET integrated database retrieval system