KEGG   Homo sapiens (human): 10384Help
Entry
10384             CDS       T01001                                 

Gene name
BTN3A3, BTF3, BTN3.3
Definition
(RefSeq) butyrophilin subfamily 3 member A3
  KO
K06712  butyrophilin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10384 (BTN3A3)
   04090 CD molecules [BR:hsa04090]
    10384 (BTN3A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   10384 (BTN3A3)
CD molecules [BR:hsa04090]
 Proteins
  10384 (BTN3A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY V-set Ig_3 I-set ig C2-set_2 Opiods_neuropep
Motif
Other DBs
NCBI-GeneID: 10384
NCBI-ProteinID: NP_008925
OMIM: 613595
HGNC: 1140
Ensembl: ENSG00000111801
Vega: OTTHUMG00000014451
Pharos: O00478(Tdark)
UniProt: O00478 A0A024R042
Structure
PDB: 

Position
6p22.2
AA seq 584 aa AA seqDB search
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWS
DTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADP
FFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATEQ
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDG
SHIYTFPHASFSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGL
ANESGEPQAEVTSLLLPAHPGAEVSPSATTNQNHKLQARTEALY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggcaagttccctggctttccttctgctcaactttcatgtctccctcttcttg
gtccagctgctcactccttgctcagctcagttttctgtgcttggaccctctgggcccatc
ctggccatggtgggtgaagacgctgatctgccctgtcacctgttcccgaccatgagtgca
gagaccatggagctgaggtgggtgagttccagcctaaggcaggtggtgaacgtgtatgca
gatggaaaggaagtggaagacaggcagagtgcaccgtatcgagggagaacttcgattctg
cgggatggcatcactgcagggaaggctgctctccgaatacacaacgtcacagcctctgac
agtggaaagtacttgtgttatttccaagatggtgacttctacgaaaaagccctggtggag
ctgaaggttgcagcattgggttctgatcttcacattgaagtgaagggttatgaggatgga
gggatccatctggagtgcaggtccactggctggtacccccaaccccaaataaagtggagc
gacaccaagggagagaacatcccggctgtggaagcacctgtggttgcagatggagtgggc
ctgtatgcagtagcagcatctgtgatcatgagaggcagctctggtgggggtgtatcctgc
atcatcagaaattccctcctcggcctggaaaagacagccagcatatccatcgcagacccc
ttcttcaggagcgcccagccctggatcgcggccctggcagggaccctgcctatctcgttg
ctgcttctcgcaggagccagttacttcttgtggagacaacagaaggaaaaaattgctctg
tccagggagacagaaagagagcgagagatgaaagaaatgggatacgctgcaacagagcaa
gaaataagcctaagagagaagctccaggaggaactcaagtggaggaaaatccagtacatg
gctcgtggagagaagtctttggcctatcatgaatggaaaatggccctcttcaaacctgcg
gatgtgattctggatccagacacggcaaacgccatcctccttgtttctgaggaccagagg
agtgtgcagcgtgctgaagagccgcgggatctgccagacaaccctgagagatttgaatgg
cgttactgtgtccttggctgtgaaaacttcacatcagggagacattactgggaggtggaa
gtgggggacagaaaagagtggcatattggggtatgtagtaagaacgtggagaggaaaaaa
ggttgggtcaaaatgacaccggagaacggatactggactatgggcctgactgatgggaat
aagtatcgggctctcactgagcccagaaccaacctgaaacttcctgagcctcctaggaaa
gtggggatcttcctggactatgagactggagagatctcgttctataatgccacagatgga
tctcatatctacacctttccgcacgcctctttctctgagcctctatatcctgttttcaga
attttgaccttggagcccactgccctgaccatttgcccaataccaaaagaagtagagagt
tcccccgatcctgacctagtgcctgatcattccctggagacaccactgaccccgggctta
gctaatgaaagtggggagcctcaggctgaagtaacatctctgcttctccctgcccaccct
ggagctgaggtctccccttctgcaacaaccaatcagaaccataagctacaggcacgcact
gaagcactttactga

DBGET integrated database retrieval system