KEGG   Homo sapiens (human): 10390
Entry
10390             CDS       T01001                                 

Gene name
CEPT1
Definition
(RefSeq) choline/ethanolamine phosphotransferase 1
  KO
K13644  choline/ethanolamine phosphotransferase [EC:2.7.8.1 2.7.8.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00440  Phosphonate and phosphinate metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    10390 (CEPT1)
   00565 Ether lipid metabolism
    10390 (CEPT1)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    10390 (CEPT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.1  ethanolaminephosphotransferase
     10390 (CEPT1)
    2.7.8.2  diacylglycerol cholinephosphotransferase
     10390 (CEPT1)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 10390
NCBI-ProteinID: NP_001007795
OMIM: 616751
HGNC: 24289
Ensembl: ENSG00000134255
Vega: OTTHUMG00000012357
Pharos: Q9Y6K0(Tbio)
UniProt: Q9Y6K0 A1PL14
Position
1p13.3
AA seq 416 aa
MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAG
RSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYI
ACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPD
WMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMHLLAVIGGPPFWQSMIP
VLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTIAGTSVLSPFLHIGSVITLA
AMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTAFIGPALLFLD
QYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgagtgggcatcgatcaacaaggaaaagatgtggagattctcacccggagtccccagtg
ggcttcgggcatatgagtactacaggatgtgtattaaataaattgtttcagttaccaaca
ccaccattgtcaagacaccaactaaagcggctagaagaacacagatatcaaagtgctgga
cggtccctgcttgagcccttaatgcaagggtattgggaatggctcgttagaagagttccc
tcctggattgccccaaatctcatcaccatcattggactgtcaataaacatctgtacaact
attttattagtcttctactgccctacagctacagagcaggcacctctgtgggcatatatt
gcttgtgcctgtggccttttcatttaccagtctttggatgctattgatgggaaacaggca
agaagaaccaatagtagttctcctctgggagaactttttgatcatggctgtgattcacta
tcaacagtttttgtggttcttggaacttgtattgcagtgcagctggggacaaaccctgat
tggatgtttttttgttgttttgcggggacatttatgttctattgtgcgcactggcaaacg
tatgtttctggaacattgcgatttggaataattgatgtgactgaagtgcaaatcttcata
ataatcatgcatttgctggcagtgattggaggaccacctttttggcaatctatgattcca
gtgctgaatattcaaatgaaaatttttcctgcactttgtactgtagcagggaccatattt
tcctgtacaaattacttccgtgtaatcttcacaggtggtgttggcaaaaatggatcaaca
atagcaggaacaagtgtcctttctccttttctccatattggatcagtgattacattagct
gcaatgatctacaagaaatctgcagttcagctttttgaaaagcatccctgtctttatata
ctgacatttggttttgtgtctgctaaaatcactaataagcttgtggttgcacacatgacg
aaaagtgaaatgcatttgcatgacacagcattcataggtccggcacttttgtttctggac
cagtattttaacagctttattgatgaatatattgtactttggattgccctggttttctct
ttctttgatttgatccgctactgtgtcagtgtttgcaatcagattgcgtctcacctgcac
atacatgtcttcagaatcaaggtctctacagctcattctaatcatcattaa

KEGG   Homo sapiens (human): 85465
Entry
85465             CDS       T01001                                 

Gene name
SELENOI, EPT1, SELI, SEPI, SPG81
Definition
(RefSeq) selenoprotein I
  KO
K00993  ethanolaminephosphotransferase [EC:2.7.8.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00440  Phosphonate and phosphinate metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    85465 (SELENOI)
   00565 Ether lipid metabolism
    85465 (SELENOI)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    85465 (SELENOI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.1  ethanolaminephosphotransferase
     85465 (SELENOI)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 85465
NCBI-ProteinID: NP_277040
OMIM: 607915
HGNC: 29361
Ensembl: ENSG00000138018
Vega: OTTHUMG00000151931
Pharos: Q9C0D9(Tbio)
UniProt: Q9C0D9
Position
2p23.3
AA seq 397 aa
MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFLL
VVFNFLLMAYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGSTGVSVFVLYLLLWVVLFSFILSHWEKYNTGIL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
NFFRSYKNNTLKLNSVYEAMVPLFSPCLLFILSTAWILWSPSDILELHPRVFYFMVGTAF
ANSTCQLIVCQMSSTRCPTLNWLLVPLFLVVLVVNLGVASYVESILLYTLTTAFTLAHIH
YGVRVVKQLSSHFQIYPFSLRKPNSDULGMEEKNIGL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggctggctacgaatacgtgagcccggagcagctggctggctttgataagtacaagtac
agtgctgtggataccaatccactttctctgtatgtcatgcatccattctggaacactata
gtaaaggtatttcctacttggctggcgcccaatctgataactttttctggctttctgctg
gtcgtattcaattttctgctaatggcatactttgatcctgacttttatgcctcagcacca
ggtcacaagcacgtgcctgactgggtttggattgtagtgggcatcctcaacttcgtagcc
tacactctagatggtgtggacggaaagcaagctcgcagaaccaattctagcactccctta
ggggagctttttgatcatggcctggatagttggtcatgtgtttactttgttgtgactgtt
tattccatctttggaagaggatcaactggtgtcagtgtttttgttctttatctcctgcta
tgggtagttttgttttctttcatcctgtcccactgggaaaagtataacacagggattctt
ttcctgccatggggatatgacattagccaggtgactatttcttttgtctacatagtgact
gcagttgtgggagttgaggcctggtatgaacctttcctgtttaatttcttatatagagac
ctattcactgcaatgattattggttgtgcattatgtgtgactcttccaatgagtttatta
aactttttcagaagctataaaaataacaccttgaaactcaattcagtctatgaagctatg
gttcccttattttctccatgcttgctgttcattttgtctacagcgtggatcctttggtca
ccttcagatattttagagctacatcctagagtattctactttatggttggaacagctttt
gccaacagtacatgtcagctgattgtttgccaaatgagtagtacccggtgtccaactttg
aattggttgctggttcctctcttcttggttgtcttagtggtaaacctaggagtagcctct
tacgttgagagcattctcctgtatacattaacaactgcttttactctggcccacatccat
tatggagtacgagtggtaaagcagctgagcagccattttcagatttaccccttctcattg
aggaaaccaaactcagattgactaggaatggaagaaaagaatattggcctgtaa

DBGET integrated database retrieval system