KEGG   Homo sapiens (human): 10393
Entry
10393             CDS       T01001                                 

Gene name
ANAPC10, APC10, DOC1
Definition
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10393 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10393 (ANAPC10)
   04114 Oocyte meiosis
    10393 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10393 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10393 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10393 (ANAPC10)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10393 (ANAPC10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     10393 (ANAPC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    10393 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 10393
NCBI-ProteinID: NP_001243635
OMIM: 613745
HGNC: 24077
Ensembl: ENSG00000164162
Vega: OTTHUMG00000161477
Pharos: Q9UM13(Tbio)
UniProt: Q9UM13
Structure
PDB: 

Position
4q31.21
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgactacaccaaacaagacacctcctggtgctgaccccaagcagttggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtggatcagttacgagatgacaatctagaaacttattggcaatcagatggttcccag
cctcatttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgagttggtggaaccaagtggctggatt
catgttcccttaactgacaatcataagaagccaactcgtacattcatgatacagattgct
gttctagccaatcaccagaatggaagagacacccatatgagacaaattaaaatatacaca
ccagtagaagagagctccattggtaaatttcctagatgtacaactatagatttcatgatg
tatcgttcaataaggtga

DBGET integrated database retrieval system