KEGG   Homo sapiens (human): 104
Entry
104               CDS       T01001                                 
Symbol
ADARB1, ADAR2, DRABA2, DRADA2, NEDHYMS, RED1
Name
(RefSeq) adenosine deaminase RNA specific B1
  KO
K13194  double stranded RNA-specific editase B [EC:3.5.-.-]
Organism
hsa  Homo sapiens (human)
Disease
H02461  Neurodevelopmental disorder with microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    104 (ADARB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-
    3.5.-.-
     104 (ADARB1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    104 (ADARB1)
SSDB
Motif
Pfam: A_deamin dsrm
Other DBs
NCBI-GeneID: 104
NCBI-ProteinID: NP_056648
OMIM: 601218
HGNC: 226
Ensembl: ENSG00000197381
Pharos: P78563(Tbio)
UniProt: P78563
Structure
Position
21:45074578..45226563
AA seq 741 aa
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRPLEEGSN
GHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAPLFVMSVEVNGQVF
EGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGF
ETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMIL
NELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLH
LDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTG
TDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEGSRSYTQAGVQWCNH
GSLQPRPPGLLSDPSTSTFQGAGTTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQ
TWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM
YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDE
LGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFI
KAGLGAWVEKPTEQDQFSLTP
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggatatagaagatgaagaaaacatgagttccagcagcactgatgtgaaggaaaaccgc
aatctggacaacgtgtcccccaaggatggcagcacacctgggcctggcgagggctctcag
ctctccaatgggggtggtggtggccccggcagaaagcggcccctggaggagggcagcaat
ggccactccaagtaccgcctgaagaaaaggaggaaaacaccagggcccgtcctccccaag
aacgccctgatgcagctgaatgagatcaagcctggtttgcagtacacactcctgtcccag
actgggcccgtgcacgcgcctttgtttgtcatgtctgtggaggtgaatggccaggttttt
gagggctctggtcccacaaagaaaaaggcaaaactccatgctgctgagaaggccttgagg
tctttcgttcagtttcctaatgcctctgaggcccacctggccatggggaggaccctgtct
gtcaacacggacttcacatctgaccaggccgacttccctgacacgctcttcaatggtttt
gaaactcctgacaaggcggagcctcccttttacgtgggctccaatggggatgactccttc
agttccagcggggacctcagcttgtctgcttccccggtgcctgccagcctagcccagcct
cctctccctgtcttaccaccattcccacccccgagtgggaagaatcccgtgatgatcttg
aacgaactgcgcccaggactcaagtatgacttcctctccgagagcggggagagccatgcc
aagagcttcgtcatgtctgtggtcgtggatggtcagttctttgaaggctcggggagaaac
aagaagcttgccaaggcccgggctgcgcagtctgccctggccgccatttttaacttgcac
ttggatcagacgccatctcgccagcctattcccagtgagggtcttcagctgcatttaccg
caggttttagctgacgctgtctcacgcctggtcctgggtaagtttggtgacctgaccgac
aacttctcctcccctcacgctcgcagaaaagtgctggctggagtcgtcatgacaacaggc
acagatgttaaagatgccaaggtgataagtgtttctacaggaacaaaatgtattaatggt
gaatacatgagtgatcgtggccttgcattaaatgactgccatgcagaaataatatctcgg
agatccttgctcagatttctttatacacaacttgagctttacttaaataacaaagatgat
caaaaaagatccatctttcagaaatcagagcgaggggggtttaggctgaaggagaatgtc
cagtttcatctgtacatcagcacctctccctgtggagatgccagaatcttctcaccacat
gagccaatcctggaagggtctcgctcttacacccaggctggagtgcagtggtgcaatcat
ggctcactgcagcctcgacctcctgggctcttaagcgatccttccacctcaaccttccaa
ggagctgggactacagaaccagcagatagacacccaaatcgtaaagcaagaggacagcta
cggaccaaaatagagtctggtgaggggacgattccagtgcgctccaatgcgagcatccaa
acgtgggacggggtgctgcaaggggagcggctgctcaccatgtcctgcagtgacaagatt
gcacgctggaacgtggtgggcatccagggatccctgctcagcattttcgtggagcccatt
tacttctcgagcatcatcctgggcagcctttaccacggggaccacctttccagggccatg
taccagcggatctccaacatagaggacctgccacctctctacaccctcaacaagcctttg
ctcagtggcatcagcaatgcagaagcacggcagccagggaaggcccccaacttcagtgtc
aactggacggtaggcgactccgctattgaggtcatcaacgccacgactgggaaggatgag
ctgggccgcgcgtcccgcctgtgtaagcacgcgttgtactgtcgctggatgcgtgtgcac
ggcaaggttccctcccacttactacgctccaagattaccaagcccaacgtgtaccatgag
tccaagctggcggcaaaggagtaccaggccgccaaggcgcgtctgttcacagccttcatc
aaggcggggctgggggcctgggtggagaagcccaccgagcaggaccagttctcactcacg
ccctga

DBGET integrated database retrieval system