KEGG   Homo sapiens (human): 10400Help
Entry
10400             CDS       T01001                                 

Gene name
PEMT, PEAMT, PEMPT, PEMT2, PLMT, PNMT
Definition
(RefSeq) phosphatidylethanolamine N-methyltransferase
  KO
K00551  phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00091  Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    10400 (PEMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     10400 (PEMT)
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     10400 (PEMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEMT Herpes_UL74 DUF1705
Motif
Other DBs
NCBI-GeneID: 10400
NCBI-ProteinID: NP_009100
OMIM: 602391
HGNC: 8830
Ensembl: ENSG00000133027
Vega: OTTHUMG00000059290
Pharos: Q9UBM1(Tbio)
UniProt: Q9UBM1
Position
17p11.2
AA seq 199 aa AA seqDB search
MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTI
LLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGD
YFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYE
EPFTAEIYRQKASGSHKRS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacccggctgctgggctacgtggaccccctggatcccagctttgtggctgccgtcatc
accatcaccttcaatccgctctactggaatgtggttgcacgatgggaacacaagacccgc
aagctgagcagggccttcggatccccctacctggcctgctactctctaagcgtcaccatc
ctgctcctgaacttcctgcgctcgcactgcttcacgcaggccatgctgagccagcccagg
atggagagcctggacacccccgcggcctacagcctgggcctcgcgctcctgggactgggc
gtcgtgctcgtgctctccagcttctttgcactggggttcgctggaactttcctaggtgat
tacttcgggatcctcaaggaggcgagagtgaccgtgttccccttcaacatcctggacaac
cccatgtactggggaagcacagccaactacctgggctgggccatcatgcacgccagcccc
acgggcctgctcctgacggtgctggtggccctcacctacatagtggctctcctatacgaa
gagcccttcaccgctgagatctaccggcagaaagcctccgggtcccacaagaggagctga

DBGET integrated database retrieval system