KEGG   Homo sapiens (human): 10406
Entry
10406             CDS       T01001                                 

Gene name
WFDC2, EDDM4, HE4, WAP5, dJ461P17.6
Definition
(RefSeq) WAP four-disulfide core domain 2
  KO
K23636  WAP four-disulfide core domain protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10406 (WFDC2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I17: WAP-type family
   10406 (WFDC2)
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 10406
NCBI-ProteinID: NP_006094
OMIM: 617548
HGNC: 15939
Ensembl: ENSG00000101443
Vega: OTTHUMG00000032594
Pharos: Q14508(Tbio)
UniProt: Q14508 A0A384MTN6
Position
20q13.12
AA seq 124 aa
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLK
CCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV
TPNF
NT seq 375 nt   +upstreamnt  +downstreamnt
atgcctgcttgtcgcctaggcccgctagccgccgccctcctcctcagcctgctgctgttc
ggcttcaccctagtctcaggcacaggagcagagaagactggcgtgtgccccgagctccag
gctgaccagaactgcacgcaagagtgcgtctcggacagcgaatgcgccgacaacctcaag
tgctgcagcgcgggctgtgccaccttctgctctctgcccaatgataaggagggttcctgc
ccccaggtgaacattaactttccccagctcggcctctgtcgggaccagtgccaggtggac
agccagtgtcctggccagatgaaatgctgccgcaatggctgtgggaaggtgtcctgtgtc
actcccaatttctga

DBGET integrated database retrieval system