KEGG   Homo sapiens (human): 10409Help
Entry
10409             CDS       T01001                                 

Gene name
BASP1, CAP-23, CAP23, NAP-22, NAP22
Definition
(RefSeq) brain abundant membrane attached signal protein 1
  KO
K17272  brain acid soluble protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10409 (BASP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   10409 (BASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BASP1
Motif
Other DBs
NCBI-GeneID: 10409
NCBI-ProteinID: NP_001258535
OMIM: 605940
HGNC: 957
Ensembl: ENSG00000176788
Vega: OTTHUMG00000131061
Pharos: P80723(Tbio)
UniProt: P80723
Position
5p15.1
AA seq 227 aa AA seqDB search
MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAAAEPAEAKEGKEKPDQ
DAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPAAGGEAP
KAAEAAAAPAESAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAA
PSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcaagctcagcaagaagaagaagggctacaatgtgaacgacgagaaagccaag
gagaaagacaagaaggccgagggcgcggcgacggaagaggaggggaccccgaaggagagt
gagccccaggcggccgcagagcccgccgaggccaaggagggcaaggagaagcccgaccag
gacgccgagggcaaggccgaggagaaggagggcgagaaggacgcggcggctgccaaggag
gaggccccgaaggcggagcccgagaagacggagggcgcggcagaggccaaggctgagccc
ccgaaggcgcccgagcaggagcaggcggcccccggccccgctgcgggcggcgaggccccc
aaagctgctgaggccgccgcggccccggccgagagcgcggcccctgccgccggggaggag
cccagcaaggaggaaggggaacccaaaaagactgaggcgcccgcagctcctgccgcccag
gagaccaaaagtgacggggccccagcttcagactcaaaacccggcagctcggaggctgcc
ccctcttccaaggagacccccgcagccacggaagcgcctagttccacacccaaggcccag
ggccccgcagcctctgcagaagagcccaagccggtggaggccccggcagctaattccgac
caaaccgtaaccgtgaaagagtga

DBGET integrated database retrieval system