KEGG   Homo sapiens (human): 10420Help
Entry
10420             CDS       T01001                                 

Gene name
TESK2
Definition
(RefSeq) testis associated actin remodelling kinase 2
  KO
K08842  testis-specific kinase 2 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     10420 (TESK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   10420 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kdo
Motif
Other DBs
NCBI-GeneID: 10420
NCBI-ProteinID: NP_009101
OMIM: 604746
HGNC: 11732
Ensembl: ENSG00000070759
Vega: OTTHUMG00000007680
Pharos: Q96S53(Tdark)
UniProt: Q96S53
Position
1p34.1
AA seq 571 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGLQTQGKQDG
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgaa
gagtttgaaggaggtggtggaggagaaggaaatgtgagccaggtgggaagagtttggcca
tcttcgtatcgagctcttataagtgccttttccagactgacgcgtttggatgatttcacc
tgtgaaaaaatagggtctggcttcttttctgaagtgttcaaggtacgacaccgagcttct
ggtcaggtgatggctcttaagatgaacacattgagcagtaaccgggcaaacatgctgaaa
gaagtacagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtatgt
gttcatcaaggacaattgcatgcacttacagagtatatcaactccgggaacctggaacag
ttgctagacagtaacctgcatttgccttggactgtgagggtaaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccccgatgtcagcatggggagtgagaagctggccgtggtgggttcccca
ttctggatggcacctgaggttctccgagatgagccctataatgaaaaggcagatgtgttc
tcttatggtatcatcctctgcgagatcatcgcccgcatccaggccgatccggactatctt
ccccgcacagagaatttcgggctggactatgatgctttccagcacatggtgggagactgt
cccccagattttctgcaacttactttcaactgctgtaacatggatcccaaactgcgccca
tcttttgtggagattgggaagaccctggaggaaattctgagccgcctacaggaagaagag
caggagagggataggaagctgcagcccacagccaggggactcttggagaaagcacctggg
gtgaagcgactaagctcactggatgacaagatcccccacaagtcaccatgcccaagacgt
accatctggctgtctcgaagccagtcagatatcttttcccgtaagcccccacgtacagtg
agtgtcttggacccatactaccggccacgagatggtgctgcccgcacccccaaagtcaac
ccttttagtgctcgccaggacctcatggggggcaagatcaagttttttgacctgcccagc
aagtctgtcatctctctggtatttgacctggatgcaccagggcccggaactatgcccctg
gctgactggcaggagcccctggccccacctattcgccggtggcgttccttgcctggttcg
cctgagttcttgcatcaagaggcttgtccatttgtgggccgggaagaatcgctatctgat
gggcccccaccacgcctaagtagtctcaagtacagagttaaagagatcccaccattccgg
gcatctgccctaccagctgctcaagcccatgaggctatggactgctccattctccaggaa
gaaaatggttttgggtccaggccccaggggaccagtccatgccctgcgggtgcttctgag
gagatggaggtagaagaaaggccagcaggctcaactccagccaccttctccacctcaggc
ataggcctgcaaacccagggaaagcaggatgggtga

DBGET integrated database retrieval system