KEGG   Homo sapiens (human): 10423Help
Entry
10423             CDS       T01001                                 

Gene name
CDIPT, PIS, PIS1
Definition
(RefSeq) CDP-diacylglycerol--inositol 3-phosphatidyltransferase
  KO
K00999  CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    10423 (CDIPT)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    10423 (CDIPT)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    10423 (CDIPT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.11  CDP-diacylglycerol---inositol 3-phosphatidyltransferase
     10423 (CDIPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-GeneID: 10423
NCBI-ProteinID: NP_006310
OMIM: 605893
HGNC: 1769
Ensembl: ENSG00000103502
Vega: OTTHUMG00000177144
Pharos: O14735(Tbio)
UniProt: O14735 A8K3L7
Position
16p11.2
AA seq 213 aa AA seqDB search
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQG
TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESH
KMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTA
PIALLKSLISVIHLITAARNMAALDAADRAKKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgaaaatatcttcctgttcgtgcccaacctcatcggttatgcccggattgtc
ttcgccatcatttctttctacttcatgccctgctgccccctcacggcctcctccttctac
ctgctcagcggcctgctggacgctttcgatggacacgctgctcgcgctcttaatcaagga
acccggtttggggccatgctggacatgctgacggaccgctgctccaccatgtgcctgttg
gtcaacctggccctgctgtaccctggagccacgctgttcttccaaatcagcatgagtttg
gatgtggccagtcactggctgcacctccacagttctgtggtccgaggcagtgagagtcac
aagatgatcgacttgtccgggaatccggtgcttcggatctactacacctcgaggcctgct
ctgttcaccttgtgtgctgggaatgagctcttctactgcctcctctacctgttccatttc
tctgagggacctttagttggctctgtgggactgttccggatgggcctctgggtcactgcc
cccatcgccttgctgaagtcgctcatcagcgtcatccacctgatcacggccgcccgcaac
atggctgccctggacgcagcagaccgcgccaagaagaagtga

DBGET integrated database retrieval system