KEGG   Homo sapiens (human): 10425Help
Entry
10425             CDS       T01001                                 

Gene name
ARIH2, ARI2, TRIAD1
Definition
(RefSeq) ariadne RBR E3 ubiquitin protein ligase 2
  KO
K11969  ariadne-2 [EC:2.3.2.31]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10425 (ARIH2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     10425 (ARIH2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    10425 (ARIH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBR zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_UBOX zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 10425
NCBI-ProteinID: NP_001304262
OMIM: 605615
HGNC: 690
Ensembl: ENSG00000177479
Vega: OTTHUMG00000133547
Pharos: O95376(Tbio)
UniProt: O95376 Q6IBL8 Q53ET9
Position
3p21.31
AA seq 493 aa AA seqDB search
MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQGADAFDPEEYQ
FTCLTYKESEGALNEHMTSLASVLKVSHSVAKLILVNFHWQVSEILDRYKSNSAQLLVEA
RVQPNPSKHVPTSHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVG
VSCMAQDCPLRTPEDFVFPLLPNEELREKYRRYLFRDYVESHYQLQLCPGADCPMVIRVQ
EPRARRVQCNRCNEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKC
NICIEKNGGCNHMQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQARE
ALKKYLFYFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKC
RYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAE
QRRRTLLKDFHDT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtggacatgaatagccaggggtctgacagcaatgaagaggactatgacccaaat
tgtgaggaagaggaagaagaagaagaagacgaccctggggacatagaggactattacgtg
ggagtagccagcgatgtggagcagcagggggctgatgcctttgatcccgaggagtaccag
ttcacttgcttgacctacaaggaatctgagggtgccctcaatgagcacatgaccagctta
gcttctgtcctaaaggtatctcattcagttgctaaacttatattagttaatttccactgg
caagtttcagagatattggacagatacaagtccaattctgctcaactgcttgttgaggct
cgagttcagcctaatccatcaaaacatgttcccacatcccatccccctcaccactgtgca
gtgtgtatgcagtttgtgcgaaaggaaaacctactctctctggcctgtcagcaccagttt
tgccgcagctgctgggagcagcactgctcagttctcgtcaaggacggcgtgggcgtggga
gtctcttgcatggctcaggactgtccactccgtacaccagaggactttgtgtttccattg
cttcccaatgaagaattgagagagaaatacaggcgctacctcttcagggactatgtggag
agtcattaccagctccagctgtgccctggtgcagactgccccatggttattcgggtacag
gagcctagagctcgccgagtacagtgcaatcggtgcaacgaggtcttctgtttcaagtgt
cgtcagatgtatcacgcacccacagactgtgccacaatccggaaatggctcacgaagtgt
gcagacgactctgaaacagccaactacattagtgctcacactaaagactgtcccaagtgc
aacatctgcattgagaagaatggaggctgcaatcacatgcaatgctccaaatgtaaacac
gacttctgctggatgtgtctaggagattggaagactcatggcagtgaatactatgagtgc
agtcgttacaaggagaatcctgacatcgtgaaccagagccaacaagcccaggcgagggaa
gccctcaagaagtacttattctactttgagaggtgggaaaaccacaataaaagcttgcag
ctagaggcacagacataccagcggattcacgagaagattcaggagagggtcatgaacaat
ctggggacatggatcgactggcagtacctacagaatgctgccaagctcttggccaagtgt
cgatacaccctgcaatacacctacccatatgcatattacatggagtccggacccaggaag
aagctgtttgaataccagcaggctcagctggaggctgagatcgaaaacctctcatggaaa
gtggagcgtgcagacagctatgacagaggggacttggagaaccagatgcatatagcggag
cagcggaggagaaccctgctgaaagatttccatgacacctaa

DBGET integrated database retrieval system