KEGG   Homo sapiens (human): 1043Help
Entry
1043              CDS       T01001                                 

Gene name
CD52, CDW52, EDDM5, HE5
Definition
(RefSeq) CD52 molecule
  KO
K06488  CDW52 antigen
Organism
hsa  Homo sapiens (human)
Drug target
Alemtuzumab: D02802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1043 (CD52)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1043 (CD52)
CD molecules [BR:hsa04090]
 Proteins
  1043 (CD52)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  1043 (CD52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD52
Motif
Other DBs
NCBI-GeneID: 1043
NCBI-ProteinID: NP_001794
OMIM: 114280
HGNC: 1804
Ensembl: ENSG00000169442
Vega: OTTHUMG00000003491
Pharos: P31358(Tclin)
UniProt: P31358 V9HWN9
Position
1p36.11
AA seq 61 aa AA seqDB search
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttcctcttcctcctactcaccatcagcctcctggttatggtacagatacaa
actggactctcaggacaaaacgacaccagccaaaccagcagcccctcagcatccagcaac
ataagcggaggcattttccttttcttcgtggccaatgccataatccacctcttctgcttc
agttga

DBGET integrated database retrieval system