KEGG   Homo sapiens (human): 10437Help
Entry
10437             CDS       T01001                                 

Gene name
IFI30, GILT, IFI-30, IP-30, IP30
Definition
(RefSeq) IFI30, lysosomal thiol reductase
  KO
K08059  interferon, gamma-inducible protein 30
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    10437 (IFI30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GILT
Motif
Other DBs
NCBI-GeneID: 10437
NCBI-ProteinID: NP_006323
OMIM: 604664
HGNC: 5398
Ensembl: ENSG00000216490
Vega: OTTHUMG00000183373
Pharos: P13284(Tbio)
UniProt: P13284 A0A024R7N7
Position
19p13.11
AA seq 250 aa AA seqDB search
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAP
LVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHG
EEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM
GDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSS
TSSLRSVCFK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtcgccacttctgctgttcctgccaccgctgctgctgctgctggacgtcccc
acggcggcggtgcaggcgtcccctctgcaagcgttagacttctttgggaatgggccacca
gttaactacaagacaggcaatctatacctgcgggggcccctgaagaagtccaatgcaccg
cttgtcaatgtgaccctctactatgaagcactgtgcggtggctgccgagccttcctgatc
cgggagctcttcccaacatggctgttggtcatggagatcctcaatgtcacgctggtgccc
tacggaaacgcacaggaacaaaatgtcagtggcaggtgggagttcaagtgccagcatgga
gaagaggagtgcaaattcaacaaggtggaggcctgcgtgttggatgaacttgacatggag
ctagccttcctgaccattgtctgcatggaagagtttgaggacatggagagaagtctgcca
ctatgcctgcagctctacgccccagggctgtcgccagacactatcatggagtgtgcaatg
ggggaccgcggcatgcagctcatgcacgccaacgcccagcggacagatgctctccagcca
ccacacgagtatgtgccctgggtcaccgtcaatgggaaacccttggaagatcagacccag
ctccttacccttgtctgccagttgtaccagggcaagaagccggatgtctgcccttcctca
accagctccctcaggagtgtttgcttcaagtga

DBGET integrated database retrieval system