KEGG   Homo sapiens (human): 10438
Entry
10438             CDS       T01001                                 

Symbol
C1D, LRP1, Rrp47, SUN-CoR, SUNCOR, hC1D
Name
(RefSeq) C1D nuclear receptor corepressor
  KO
K12592  exosome complex protein LRP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    10438 (C1D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10438 (C1D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     10438 (C1D)
SSDB
Motif
Pfam: Sas10_Utp3 TBCC_N
Other DBs
NCBI-GeneID: 10438
NCBI-ProteinID: NP_001177192
OMIM: 606997
HGNC: 29911
Ensembl: ENSG00000197223
Vega: OTTHUMG00000129564
Pharos: Q13901(Tbio)
UniProt: Q13901
Position
2p14
AA seq 141 aa
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKN
ALWEPKSKNASKVANKGKSKS
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcaggtgaagaaattaatgaagactatccagtagaaattcacgagtatttgtcagcg
tttgagaattccattggtgctgtggatgagatgctgaagaccatgatgtctgtttctaga
aatgagttgttgcagaagttggatccacttgaacaagcaaaagtggatttggtttctgca
tacacattaaattcaatgttttgggtttatttggcaacccaaggagttaatcctaaggaa
catccagtaaaacaggaattggaaagaatcagagtatatatgaacagagtcaaggaaata
acagacaagaaaaaggctggcaagctggacagaggtgcagcttcaagatttgtaaaaaat
gccctctgggaaccaaaatcgaaaaatgcatcaaaagttgccaataaaggaaaaagtaaa
agttaa

DBGET integrated database retrieval system