KEGG   Homo sapiens (human): 10443Help
Entry
10443             CDS       T01001                                 

Gene name
N4BP2L2, 92M18.3, CG005, CG016, PFAAP5
Definition
(RefSeq) NEDD4 binding protein 2 like 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_33 AAA_18 Zeta_toxin KTI12 AAA_16 ABC_tran TsaE AAA_22
Motif
Other DBs
NCBI-GeneID: 10443
NCBI-ProteinID: NP_055702
OMIM: 615788
HGNC: 26916
Ensembl: ENSG00000244754
Vega: OTTHUMG00000016700
Pharos: Q92802(Tbio)
UniProt: Q92802 A0A024RDV2
Position
13q13.1
AA seq 583 aa AA seqDB search
MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTII
DVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTS
KAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLG
NEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNP
PSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR
ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNI
QAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMS
ISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatggtgaaattgaaggtaaattcttgggacctagagaagaagtaacgagtgag
ccacgctgtaaaaaattgaagtcaaccacagagtcgtatgtttttcacaatcatagtaat
gctgattttcacagaatccaagagaaaactggaaatgattgggtccctgtgaccatcatt
gatgtcagaggacatagttatttgcaggagaacaaaatcaaaactacagatttgcataga
cctttgcatgatgagatgcctggtaatagaccagatgttattgaatccattgattcacag
gttttacaggaagcacgtcctccattagtatccgcagacgatgagatatatagcacaagt
aaagcatttataggacccatttacaaaccccctgagaaaaagaaacgtaatgaagggagg
aatgaggcacatgttctaaatggtataaatgacagaggaggacaaaaagagaaacagaaa
tttaactctgaaaaatcagagattgacaatgaattattccagttttacaaagaaattgaa
gagcttgaaaaggaaaaagatggttttgagaacagttgtaaagaatctgaaccttctcag
gaacaatttgttccattttatgagggtcataataatggtctcttaaaacctgatgaagaa
aagaaagatcttagtaataaagctatgccatcacattgtgattatcagcagaacttgggg
aatgagccagacaaatatccctgtaatggacaagtaatacctacattttgtgacacttca
tttacttctttcaggcctgaatggcagtcagtatatccttttatagtgccctatggtccc
cctcttcccagtttgaactatcatttaaacattcagagattcagtggtccaccaaatcca
ccatcaaatattttccaagcccaagatgactctcagatacaaaatggatattatgtaaat
aattgtcatgttaactggaattgcatgacttttgatcagaacaatgaatatactgactgt
agtgagaataggagtagtgttcatccctctggaaatggctgcagtatgcaagatcgatat
gtgagtaatggtttctgtgaagtcagagaaagatgctggaaagatcattgtatggacaag
cataatggaacagacaggtttgtgaaccagcagtttcaagaggaaaagttaaataaattg
cagaagttacttattcttttaagaggtctgcctggttctgggaaaacaacattgtctcga
attctgcttggtcagaatcgtgatggcattgtgttcagcactgatgactattttcaccat
caagatgggtacaggtataatgttaatcaacttggtgatgcccatgactggaaccagaac
agagcaaaacaagctatcgatcagggaagatctccagttataatagataacactaatata
caagcttgggaaatgaagccatatgtggaagtggccataggaaaaggatacagagtagag
tttcatgaacctgaaacttggtggaaatttgatcctgaagaattagaaaagaggaataaa
catggtgtgtctcgaaagaagattgctcagatgttggatcgttatgaatatcaaatgtcc
atttctattgtaatgaattcagtggaaccatcacacaaaagcacacaaagacctcctcct
ccacaggggagacagaggtggggaggctctcttggctcacataatcgtgtctgtgtcaca
aataatcattaa

DBGET integrated database retrieval system