KEGG   Homo sapiens (human): 10443
Entry
10443             CDS       T01001                                 
Symbol
N4BP2L2, 92M18.3, CG005, CG016, PFAAP5
Name
(RefSeq) NEDD4 binding protein 2 like 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: AAA_33 AAA_18 Zeta_toxin KTI12 nSTAND3 DUF5906 AAA_22 AAA_16 ABC_tran
Other DBs
NCBI-GeneID: 10443
NCBI-ProteinID: NP_055702
OMIM: 615788
HGNC: 26916
Ensembl: ENSG00000244754
UniProt: Q92802
Position
13:complement(32432485..32538868)
AA seq 583 aa
MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTII
DVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEARPPLVSADDEIYSTS
KAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLG
NEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIVPYGPPLPSLNYHLNIQRFSGPPNP
PSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSR
ILLGQNRDGIVFSTDDYFHHQDGYRYNVNQLGDAHDWNQNRAKQAIDQGRSPVIIDNTNI
QAWEMKPYVEVAIGKGYRVEFHEPETWWKFDPEELEKRNKHGVSRKKIAQMLDRYEYQMS
ISIVMNSVEPSHKSTQRPPPPQGRQRWGGSLGSHNRVCVTNNH
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtcttatggtgaaattgaaggtaaattcttgggacctagagaagaagtaacgagtgag
ccacgctgtaaaaaattgaagtcaaccacagagtcgtatgtttttcacaatcatagtaat
gctgattttcacagaatccaagagaaaactggaaatgattgggtccctgtgaccatcatt
gatgtcagaggacatagttatttgcaggagaacaaaatcaaaactacagatttgcataga
cctttgcatgatgagatgcctggtaatagaccagatgttattgaatccattgattcacag
gttttacaggaagcacgtcctccattagtatccgcagacgatgagatatatagcacaagt
aaagcatttataggacccatttacaaaccccctgagaaaaagaaacgtaatgaagggagg
aatgaggcacatgttctaaatggtataaatgacagaggaggacaaaaagagaaacagaaa
tttaactctgaaaaatcagagattgacaatgaattattccagttttacaaagaaattgaa
gagcttgaaaaggaaaaagatggttttgagaacagttgtaaagaatctgaaccttctcag
gaacaatttgttccattttatgagggtcataataatggtctcttaaaacctgatgaagaa
aagaaagatcttagtaataaagctatgccatcacattgtgattatcagcagaacttgggg
aatgagccagacaaatatccctgtaatggacaagtaatacctacattttgtgacacttca
tttacttctttcaggcctgaatggcagtcagtatatccttttatagtgccctatggtccc
cctcttcccagtttgaactatcatttaaacattcagagattcagtggtccaccaaatcca
ccatcaaatattttccaagcccaagatgactctcagatacaaaatggatattatgtaaat
aattgtcatgttaactggaattgcatgacttttgatcagaacaatgaatatactgactgt
agtgagaataggagtagtgttcatccctctggaaatggctgcagtatgcaagatcgatat
gtgagtaatggtttctgtgaagtcagagaaagatgctggaaagatcattgtatggacaag
cataatggaacagacaggtttgtgaaccagcagtttcaagaggaaaagttaaataaattg
cagaagttacttattcttttaagaggtctgcctggttctgggaaaacaacattgtctcga
attctgcttggtcagaatcgtgatggcattgtgttcagcactgatgactattttcaccat
caagatgggtacaggtataatgttaatcaacttggtgatgcccatgactggaaccagaac
agagcaaaacaagctatcgatcagggaagatctccagttataatagataacactaatata
caagcttgggaaatgaagccatatgtggaagtggccataggaaaaggatacagagtagag
tttcatgaacctgaaacttggtggaaatttgatcctgaagaattagaaaagaggaataaa
catggtgtgtctcgaaagaagattgctcagatgttggatcgttatgaatatcaaatgtcc
atttctattgtaatgaattcagtggaaccatcacacaaaagcacacaaagacctcctcct
ccacaggggagacagaggtggggaggctctcttggctcacataatcgtgtctgtgtcaca
aataatcattaa

DBGET integrated database retrieval system