KEGG   Homo sapiens (human): 10447
Entry
10447             CDS       T01001                                 

Gene name
FAM3C, GS3786, ILEI
Definition
(RefSeq) FAM3 metabolism regulating signaling molecule C
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ILEI
Other DBs
NCBI-GeneID: 10447
NCBI-ProteinID: NP_001035109
OMIM: 608618
HGNC: 18664
Ensembl: ENSG00000196937
Vega: OTTHUMG00000156979
Pharos: Q92520(Tbio)
UniProt: Q92520
Structure
PDB: 
5LC2

Position
7q31.31
AA seq 227 aa
MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGI
SKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTK
YFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRD
NWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagggtagcaggtgctgcaaagttggtggtagctgtggcagtgtttttactgacattt
tatgttatttctcaagtatttgaaataaaaatggatgcaagtttaggaaatctatttgca
agatcagcattggacacagctgcacgttctacaaagcctcccagatataagtgtgggatc
tcaaaagcttgccctgagaagcattttgcttttaaaatggcaagtggagcagccaacgtg
gtgggacccaaaatctgcctggaagataatgttttaatgagtggtgttaagaataatgtt
ggaagagggatcaatgttgccttggcaaatggaaaaacaggagaagtattagacactaaa
tattttgacatgtggggaggagatgtggcaccatttattgagtttctgaaggccatacaa
gatggaacaatagttttaatgggaacatacgatgatggagcaaccaaactcaatgatgag
gcacggcggctcattgctgatttggggagcacatctattactaatcttggttttagagac
aactgggtcttctgtggtgggaagggcattaagacaaaaagcccttttgaacagcacata
aagaacaataaggatacaaacaaatatgaaggatggcctgaagttgtagaaatggaagga
tgcatcccccagaagcaagactaa

DBGET integrated database retrieval system