KEGG   Homo sapiens (human): 10450
Entry
10450             CDS       T01001                                 

Gene name
PPIE, CYP-33, CYP33
Definition
(RefSeq) peptidylprolyl isomerase E
  KO
K09564  peptidyl-prolyl isomerase E (cyclophilin E) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10450 (PPIE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10450 (PPIE)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10450 (PPIE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     10450 (PPIE)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    10450 (PPIE)
 Complex C
    10450 (PPIE)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    10450 (PPIE)
SSDB
Motif
Pfam: Pro_isomerase RRM_1 RRM_5 RRM_occluded DUF4944 RRM_7
Other DBs
NCBI-GeneID: 10450
NCBI-ProteinID: NP_006103
OMIM: 602435
HGNC: 9258
Ensembl: ENSG00000084072
Vega: OTTHUMG00000009248
Pharos: Q9UNP9(Tbio)
UniProt: Q9UNP9
Structure
PDB: 

Position
1p34.2
AA seq 301 aa
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSE
PPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEY
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccaccaccaagcgcgtcttgtacgtgggtggactggcagaggaagtggacgacaaa
gttcttcatgctgcgttcattccttttggagacatcacagatattcagattcctctggat
tatgaaacagaaaagcaccgaggatttgcttttgttgaatttgagttggcagaggatgct
gcagcagctatcgacaacatgaatgaatctgagctttttggacgtacaattcgtgtcaat
ttggccaaaccaatgagaattaaggaaggctcttccaggccagtttggtcagatgatgac
tggttgaagaagttttctgggaagacgcttgaagagaataaagaggaagaagggtcagag
cctcccaaagcagagacccaggagggagagcccattgctaaaaaggcccgctcaaatcct
caggtgtacatggacatcaagattgggaacaagccggctggccgcatccagatgctcctg
cgttctgatgtcgtgcccatgacagcagagaatttccgctgcctgtgcactcatgaaaag
ggctttggctttaagggaagcagcttccaccgcatcatcccccagttcatgtgccagggc
ggtgatttcacaaaccacaatggcactgggggcaagtccatctatgggaagaagttcgat
gatgaaaactttatcctcaagcatacgggaccaggtctactatccatggccaactctggc
ccaaacaccaatggctctcagttcttcctgacatgtgacaagacagactggctggatggc
aagcatgtggtgtttggagaggtcaccgaaggcctagatgtcttgcggcaaattgaggcc
cagggcagcaaggacgggaagccaaagcagaaggtgatcatcgccgactgtggggagtac
gtgtga

DBGET integrated database retrieval system