KEGG   Homo sapiens (human): 10451Help
Entry
10451             CDS       T01001                                 

Gene name
VAV3
Definition
(RefSeq) vav guanine nucleotide exchange factor 3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10451 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10451 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10451 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    10451 (VAV3)
   04660 T cell receptor signaling pathway
    10451 (VAV3)
   04662 B cell receptor signaling pathway
    10451 (VAV3)
   04664 Fc epsilon RI signaling pathway
    10451 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    10451 (VAV3)
   04670 Leukocyte transendothelial migration
    10451 (VAV3)
   04062 Chemokine signaling pathway
    10451 (VAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_9 SH3_1 SH2 C1_1 PH CDC24 Filamin PH_10 Prok-RING_1 Zn_ribbon_17 C1_2 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 10451
NCBI-ProteinID: NP_006104
OMIM: 605541
HGNC: 12659
Ensembl: ENSG00000134215
Vega: OTTHUMG00000010995
Pharos: Q9UKW4(Tbio)
UniProt: Q9UKW4
Structure
PDB: 

Position
1p13.3
AA seq 847 aa AA seqDB search
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgcagtggctcatccattgcaaggtgctgcccaccaac
caccgggtgacctgggactcggctcaggtgttcgaccttgcgcagaccctccgcgatgga
gtcctgctctgccagctgcttaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagtttctctgtttgaagaacataaggacatttctcacg
gcctgttgtgagacgtttggaatgaggaaaagtgaacttttcgaggcatttgacttgttt
gatgttcgtgactttggaaaggttatagaaacattatcacgactttctcgaacacctata
gcattggccacaggaatcaggcccttcccaacagaagaaagcattaatgatgaagacatc
tacaaaggccttcctgatttaatagatgaaacccttgtggaagatgaagaagatctctat
gactgtgtttatggggaagatgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcagcccaaatgtccagaaaatgatatacgaagttgttgtctagcagaaatt
aagcagacagaagaaaaatatacagaaactttggagtcaatagaaaagtatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaacttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccagaacttgtaccaagtttttattaactacaaggaaagattggttatttacgggcag
tactgcagtggagtggagtcagccatctctagtttagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttccaaaagagcaaataatgggaaatttactctt
cgagacttgcttgtggttcctatgcaacgtgttttaaagtaccaccttctcctccaggaa
ctggtcaaacataccactgatccgactgagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagagaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcataccaaacaagaaagg
catatcttcttatttgatttggcagtgatcgtatgtaagagaaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaataatcctacaaccgataaa
gaaaacaaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaagaaatggctagaacagtttgaaatggct
ttgtctaacataagaccagactatgcagactccaatttccacgacttcaagatgcatacc
ttcactcgagtcacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgttttaagtgtggagcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctggtgaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcctaaacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctctgcatgaaggaccccctttacagctccag
gccggggataccgttgaacttctgaaaggagatgcacacagtctgttttggcagggcaga
aatttagcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagaccgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggcaacagcttgttaagtccaaaagtgctgggcattgccatcgctcggtatgacttctgt
gcaagagatatgagagagttgtccttgttgaaaggagatgtggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acatatgtggaagaggatgaataa

DBGET integrated database retrieval system