KEGG   Homo sapiens (human): 10451Help
Entry
10451             CDS       T01001                                 

Gene name
VAV3
Definition
(RefSeq) vav guanine nucleotide exchange factor 3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10451 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    10451 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10451 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    10451 (VAV3)
   04660 T cell receptor signaling pathway
    10451 (VAV3)
   04662 B cell receptor signaling pathway
    10451 (VAV3)
   04664 Fc epsilon RI signaling pathway
    10451 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    10451 (VAV3)
   04670 Leukocyte transendothelial migration
    10451 (VAV3)
   04062 Chemokine signaling pathway
    10451 (VAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 Filamin LZ3wCH PH_10 PH_16 Prok-RING_1 IQ_SEC7_PH Zn_ribbon_17 C1_2 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 10451
NCBI-ProteinID: NP_006104
OMIM: 605541
HGNC: 12659
Ensembl: ENSG00000134215
Vega: OTTHUMG00000010995
Pharos: Q9UKW4(Tbio)
UniProt: Q9UKW4
Structure
PDB: 

Position
1p13.3
AA seq 847 aa AA seqDB search
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgcagtggctcatccattgcaaggtgctgcccaccaac
caccgggtgacctgggactcggctcaggtgttcgaccttgcgcagaccctccgcgatgga
gtcctgctctgccagctgcttaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagtttctctgtttgaagaacataaggacatttctcacg
gcctgttgtgagacgtttggaatgaggaaaagtgaacttttcgaggcatttgacttgttt
gatgttcgtgactttggaaaggttatagaaacattatcacgactttctcgaacacctata
gcattggccacaggaatcaggcccttcccaacagaagaaagcattaatgatgaagacatc
tacaaaggccttcctgatttaatagatgaaacccttgtggaagatgaagaagatctctat
gactgtgtttatggggaagatgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcagcccaaatgtccagaaaatgatatacgaagttgttgtctagcagaaatt
aagcagacagaagaaaaatatacagaaactttggagtcaatagaaaagtatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaacttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccagaacttgtaccaagtttttattaactacaaggaaagattggttatttacgggcag
tactgcagtggagtggagtcagccatctctagtttagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttccaaaagagcaaataatgggaaatttactctt
cgagacttgcttgtggttcctatgcaacgtgttttaaagtaccaccttctcctccaggaa
ctggtcaaacataccactgatccgactgagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagagaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcataccaaacaagaaagg
catatcttcttatttgatttggcagtgatcgtatgtaagagaaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaataatcctacaaccgataaa
gaaaacaaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaagaaatggctagaacagtttgaaatggct
ttgtctaacataagaccagactatgcagactccaatttccacgacttcaagatgcatacc
ttcactcgagtcacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgttttaagtgtggagcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctggtgaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcctaaacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctctgcatgaaggaccccctttacagctccag
gccggggataccgttgaacttctgaaaggagatgcacacagtctgttttggcagggcaga
aatttagcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagaccgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggcaacagcttgttaagtccaaaagtgctgggcattgccatcgctcggtatgacttctgt
gcaagagatatgagagagttgtccttgttgaaaggagatgtggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acatatgtggaagaggatgaataa

KEGG   Homo sapiens (human): 7409Help
Entry
7409              CDS       T01001                                 

Gene name
VAV1, VAV
Definition
(RefSeq) vav guanine nucleotide exchange factor 1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7409 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7409 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7409 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    7409 (VAV1)
   04660 T cell receptor signaling pathway
    7409 (VAV1)
   04662 B cell receptor signaling pathway
    7409 (VAV1)
   04664 Fc epsilon RI signaling pathway
    7409 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    7409 (VAV1)
   04670 Leukocyte transendothelial migration
    7409 (VAV1)
   04062 Chemokine signaling pathway
    7409 (VAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH3_9 SH2 C1_1 PH CDC24 C1_2 LZ3wCH PH_16 DUF4335
Motif
Other DBs
NCBI-GeneID: 7409
NCBI-ProteinID: NP_005419
OMIM: 164875
HGNC: 12657
Ensembl: ENSG00000141968
Vega: OTTHUMG00000181965
Pharos: P15498(Tchem)
UniProt: P15498 Q96D37 B2R8B5
Structure
PDB: 

Position
19p13.3
AA seq 845 aa AA seqDB search
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtggcgccaatgcacccactggctcatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctgtgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagttcggcctcaagcggagcgagctcttcgaagcctttgacctcttc
gatgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagatccagcagacggaggagaagtacactgacacgctgggctccatccagcagcatttc
ttgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttcctcgtctat
ggccgctactgcagccaggtggagtcagccagcaaacacctggaccgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagagagccaacaacgggaggttc
accctgcgggacctgctgatggtgcctatgcagcgagttctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggaggcgatggagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cgacagatcaccaatttccagctgtccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggaactcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctactcatctgtaagcgcaggggagactcc
tatgacctcaaggactttgtaaacctgcacagcttccaggttcgggatgactcttcagga
gaccgagacaacaagaagtggagccacatgttcctcctgatcgaggaccaaggtgcccag
ggctatgagctgttcttcaagacaagagaattgaagaagaagtggatggagcagtttgag
atggccatctccaacatctatccggagaatgccaccgccaacgggcatgacttccagatg
ttctcctttgaggagaccacatcctgcaaggcctgtcagatgctgcttagaggtaccttc
tatcagggctaccgctgccatcggtgccgggcatctgcacacaaggagtgtctggggagg
gtccctccatgtggccgacatgggcaagatttcccaggaactatgaagaaggacaaacta
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttt
caggaatactacgggcttcctccaccccctggagccattggaccctttctacggctcaac
cctggagacattgtggagctcacgaaggctgaggctgaacagaactggtgggagggcaga
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctatgtccat
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggagcgggcaggg
gcagagagcatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaag
gatgcagcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatc
atgacagcagaaggactgtaccggatcacagagaaaaaggctttccgggggcttacggag
ctggtggagttttaccagcagaactctctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgaaaagagaaccatcagcaggccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgcccgagaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

KEGG   Homo sapiens (human): 7410Help
Entry
7410              CDS       T01001                                 

Gene name
VAV2, VAV-2
Definition
(RefSeq) vav guanine nucleotide exchange factor 2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    7410 (VAV2)
   04024 cAMP signaling pathway
    7410 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7410 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7410 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    7410 (VAV2)
   04660 T cell receptor signaling pathway
    7410 (VAV2)
   04662 B cell receptor signaling pathway
    7410 (VAV2)
   04664 Fc epsilon RI signaling pathway
    7410 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    7410 (VAV2)
   04670 Leukocyte transendothelial migration
    7410 (VAV2)
   04062 Chemokine signaling pathway
    7410 (VAV2)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    7410 (VAV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 C1_1 PH SH2_2 CDC24 C1_2 PLU-1 PH_10 Zn_ribbon_17 zf-RING-like
Motif
Other DBs
NCBI-GeneID: 7410
NCBI-ProteinID: NP_001127870
OMIM: 600428
HGNC: 12658
Ensembl: ENSG00000160293
Vega: OTTHUMG00000020882
Pharos: P52735(Tbio)
UniProt: P52735
Structure
PDB: 

Position
9q34.2
AA seq 878 aa AA seqDB search
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgattgcaaggtcctgccgcccaac
caccgggtggtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtccttctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagtttctgtgtttgaagaacatacgcaccttcctgaaa
gtctgccacgataaatttggattaaggaacagcgagctgtttgacccctttgacctcttc
gatgtgcgagactttggaaaggtcatctccgcggtgtcgaggctctccctgcacagcatc
gcgcagaacaaagggatcaggccttttccctcagaggagaccacagagaatgacgatgac
gtctaccgcagcctggaggagctggccgacgagcatgacctgggggaggacatctacgac
tgcgtcccgtgtgaggatggaggggacgacatctacgaggacatcatcaaggtggaggtg
cagcagcccatgattagatacatgcagaaaatgggcatgactgaagatgacaagaggaac
tgctgcctgctggagatccaggagaccgaggccaagtactaccgcaccctggaggacatt
gagaagaactacatgagccccctgcggctggtgctgagcccggcggacatggcagctgtc
ttcattaacctggaggacctgatcaaggtgcatcacagcttcctgagggccatcgacgtg
tccgtgatggtggggggcagcacgctggccaaggtcttcctcgatttcaaggaaaggctt
ctgatctacggggagtactgcagccacatggagcacgcccagaacacactgaaccagctc
ctggccagccgggaggacttcaggcagaaagtcgaggagtgcacactgaaggtccaggat
ggaaaatttaagctgcaagacctgctggtggtccccatgcagagggtgctcaaataccac
ctgctcttgaaggagcttctgagccattctgcggaacggcctgagaggcagcagctcaaa
gaagcactggaagccatgcaggacttggcgatgtacatcaatgaagttaaacgggacaag
gagaccttgaggaaaatcagcgaatttcagagttctatagaaaatttgcaagtgaaactg
gaggaatttggaagaccaaagattgacggggaactgaaagtccggtccatagtcaaccac
accaagcaggacaggtacttgttcctgtttgacaaggtggtcatcgtctgcaagcggaag
ggctacagctacgagctcaaggagatcatcgagctgctgttccacaagatgaccgacgac
cccatgaacaacaaggacgtcaagaagtctcacgggaaaatgtggtcctacggcttctac
ctaattcaccttcaaggaaagcagggcttccagtttttctgcaaaacagaagatatgaag
aggaagtggatggagcagtttgagatggccatgtcaaacatcaagccagacaaagccaat
gccaaccaccacagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgc
aaaatgttcctcaggggcaccttctaccagggatacatgtgtaccaagtgtggcgtcggg
gcacacaaggagtgcctggaagtgatacctccctgcaagttcacttctcctgcagatctg
gacgcctccggagcgggaccaggtcccaagatggtggccatgcagaattaccatggcaac
ccagcccctcccgggaagcctgtgctgaccttccagacgggcgacgtgcttgagctgctg
aggggcgaccctgagtctccgtggtgggagggtcgtctggtacaaaccaggaagtcaggg
tatttccccagctcatctgtgaagccctgccctgtggatggaaggccgcccatcagccgg
ccgccatcccgggagatcgactacactgcatacccctggtttgcaggtaacatggagagg
cagcagacggacaacctgctcaagtcccacgccagcgggacctacctgatcagggagcgg
cctgccgaggctgagcgctttgcaataagcatcaagttcaatgatgaggtgaagcacatc
aaggtggtggagaaggacaactggatccacatcacagaggccaagaaattcgacagcctc
ctggagttggtggagtactaccagtgccactcactgaaggagagcttcaagcagctggac
accacactcaagtacccctacaagtcccgggaacgttcggcctccagggcctccagccgg
tccccagcttcctgtgcttcctacaacttttcttttctcagtcctcagggcctcagcttt
gcttctcagggcccctccgctcccttctggtcagtgttcacgccccgcgtcatcggcaca
gctgtggccaggtataactttgccgcccgagatatgagggagctttcgctgcgggagggt
gacgtggtgaggatctacagccgcatcggcggagaccagggctggtggaagggcgagacc
aacggacggattggctggtttccttcaacgtacgtagaagaggagggcatccagtga

DBGET integrated database retrieval system