KEGG   Homo sapiens (human): 10457
Entry
10457             CDS       T01001                                 
Symbol
GPNMB, HGFIN, NMB, PLCA3
Name
(RefSeq) glycoprotein nmb
  KO
K20732  transmembrane glycoprotein NMB
Organism
hsa  Homo sapiens (human)
Disease
H01217  Primary localized cutaneous amyloidosis
Drug target
Glembatumumab: D09623
Glembatumumab vedotin: D09912
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10457 (GPNMB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Others
    10457 (GPNMB)
SSDB
Motif
Pfam: PKAT_KLD PKD_4 PKD TMEM132D_C
Other DBs
NCBI-GeneID: 10457
NCBI-ProteinID: NP_001005340
OMIM: 604368
HGNC: 4462
Ensembl: ENSG00000136235
Pharos: Q14956(Tbio)
UniProt: Q14956
Position
7:23246775..23275108
AA seq 572 aa
MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYP
VWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNC
RNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL
GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFV
TMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHTVN
HTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLE
LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS
TLISVPDRDPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKG
LSVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggaatgtctctactatttcctgggatttctgctcctggctgcaagattgccacttgat
gccgccaaacgatttcatgatgtgctgggcaatgaaagaccttctgcttacatgagggag
cacaatcaattaaatggctggtcttctgatgaaaatgactggaatgaaaaactctaccca
gtgtggaagcggggagacatgaggtggaaaaactcctggaagggaggccgtgtgcaggcg
gtcctgaccagtgactcaccagccctcgtgggctcaaatataacatttgcggtgaacctg
atattccctagatgccaaaaggaagatgccaatggcaacatagtctatgagaagaactgc
agaaatgaggctggtttatctgctgatccgtatgtttacaactggacagcatggtcagag
gacagtgacggggaaaatggcaccggccaaagccatcataacgtcttccctgatgggaaa
ccttttcctcaccaccccggatggagaagatggaatttcatctacgtcttccacacactt
ggtcagtatttccagaaattgggacgatgttcagtgagagtttctgtgaacacagccaat
gtgacacttgggcctcaactcatggaagtgactgtctacagaagacatggacgggcatat
gttcccatcgcacaagtgaaagatgtgtacgtggtaacagatcagattcctgtgtttgtg
actatgttccagaagaacgatcgaaattcatccgacgaaaccttcctcaaagatctcccc
attatgtttgatgtcctgattcatgatcctagccacttcctcaattattctaccattaac
tacaagtggagcttcggggataatactggcctgtttgtttccaccaatcatactgtgaat
cacacgtatgtgctcaatggaaccttcagccttaacctcactgtgaaagctgcagcacca
ggaccttgtccgccaccgccaccaccacccagaccttcaaaacccaccccttctttagca
actactctaaaatcttatgattcaaacaccccaggacctgctggtgacaaccccctggag
ctgagtaggattcctgatgaaaactgccagattaacagatatggccactttcaagccacc
atcacaattgtagagggaatcttagaggttaacatcatccagatgacagacgtcctgatg
ccggtgccatggcctgaaagctccctaatagactttgtcgtgacctgccaagggagcatt
cccacggaggtctgtaccatcatttctgaccccacctgcgagatcacccagaacacagtc
tgcagccctgtggatgtggatgagatgtgtctgctgactgtgagacgaaccttcaatggg
tctgggacgtactgtgtgaacctcaccctgggggatgacacaagcctggctctcacgagc
accctgatttctgttcctgacagagacccagcctcgcctttaaggatggcaaacagtgcc
ctgatctccgttggctgcttggccatatttgtcactgtgatctccctcttggtgtacaaa
aaacacaaggaatacaacccaatagaaaatagtcctgggaatgtggtcagaagcaaaggc
ctgagtgtctttctcaaccgtgcaaaagccgtgttcttcccgggaaaccaggaaaaggat
ccgctactcaaaaaccaagaatttaaaggagtttcttaa

DBGET integrated database retrieval system