KEGG   Homo sapiens (human): 10458
Entry
10458             CDS       T01001                                 
Symbol
BAIAP2, BAP2, FLAF3, IRSP53, WAML
Name
(RefSeq) BAR/IMD domain containing adaptor protein 2
  KO
K05627  BAI1-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01094  Escherichia Eae/Tir/TccP to Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10458 (BAIAP2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10458 (BAIAP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10458 (BAIAP2)
   05135 Yersinia infection
    10458 (BAIAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10458 (BAIAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    10458 (BAIAP2)
SSDB
Motif
Pfam: IMD SH3_2 SH3_9 SH3_1 BAR RasGAP BAR_3 Peptidase_Mx1
Other DBs
NCBI-GeneID: 10458
NCBI-ProteinID: NP_059345
OMIM: 605475
HGNC: 947
Ensembl: ENSG00000175866
Pharos: Q9UQB8(Tbio)
UniProt: Q9UQB8
Structure
Position
17:81035151..81117434
AA seq 552 aa
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
HGDGSARTLAGR
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtctctgtctcgctcagaggagatgcaccggctcacggaaaatgtctataagaccatc
atggagcagttcaaccctagcctccggaacttcatcgccatggggaagaattacgagaag
gcactggcaggtgtgacgtatgcagccaaaggctactttgacgccctggtgaagatgggg
gagctggccagcgagagccagggctccaaagaactcggagacgttctcttccagatggct
gaagtccacaggcagatccagaatcagctggaagaaatgctgaagtcttttcacaacgag
ctgcttacgcagctggagcagaaggtggagctggactccaggtatctgagtgctgcgctg
aagaaataccagactgagcaaaggagcaaaggcgacgccctggacaagtgtcaggctgag
ctgaagaagcttcggaagaagagccagggcagcaagaatcctcagaagtactcggacaag
gagctgcagtacatcgacgccatcagcaacaagcagggcgagctggagaattacgtgtcc
gacggctacaagaccgcactgacagaggagcgcaggcgcttctgcttcctggtggagaag
cagtgcgccgtggccaagaactccgcggcctaccactccaagggcaaggagctgctggcg
cagaagctgccgctgtggcaacaggcctgtgccgaccccagcaagatcccggagcgcgcg
gtgcagctcatgcagcaggtggccagcaacggcgccaccctccccagcgccctgtcggcc
tccaagtccaacctggtcatttccgaccccattccgggggccaagcccctgccggtgccc
cccgagctggcaccgttcgtggggcggatgtctgcccaggagagcacacccatcatgaac
ggcgtcacaggcccggatggcgaggactacagcccgtgggctgaccgcaaggctgcccag
cccaaatccctgtctcctccgcagtctcagagcaagctcagcgactcctactccaacaca
ctccccgtgcgcaagagcgtgaccccaaaaaacagctatgccaccaccgagaacaagact
ctgcctcgctcgagctccatggcagccggcctggagcgcaatggccgtatgcgggtgaag
gccatcttctcccacgctgctggggacaacagcaccctcctgagcttcaaggagggtgac
ctcattaccctgctggtgcctgaggcccgcgatggctggcactacggagagagtgagaag
accaagatgcggggctggtttcccttctcctacacccgggtcttggacagcgatggcagt
gacaggctgcacatgagcctgcagcaagggaagagcagcagcacgggcaacctcctggac
aaggacgacctggccatcccaccccccgattacggcgccgcctcccgggccttccccgcc
cagacggccagcggcttcaagcagaggccctacagtgtggccgtgcccgccttctcccag
ggcctggatgactatggagcgcggtccatgagcaggaatccctttgcccacgtccagctg
aagccgacagtgaccaacgacaggtgtgatctgtccgcccaagggccagaaggccgggag
cacggggatgggagcgcccgcaccctggctggaagatga

DBGET integrated database retrieval system