KEGG   Homo sapiens (human): 10458Help
Entry
10458             CDS       T01001                                 

Gene name
BAIAP2, BAP2, FLAF3, IRSP53
Definition
(RefSeq) BAI1 associated protein 2
  KO
K05627  BAI1-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    10458 (BAIAP2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10458 (BAIAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    10458 (BAIAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMD SH3_9 SH3_2 SH3_1 BAR BAR_3 RasGAP Peptidase_Mx1
Motif
Other DBs
NCBI-GeneID: 10458
NCBI-ProteinID: NP_059345
OMIM: 605475
HGNC: 947
Ensembl: ENSG00000175866
Vega: OTTHUMG00000177698
Pharos: Q9UQB8(Tbio)
UniProt: Q9UQB8
Structure
PDB: 

Position
17q25.3
AA seq 552 aa AA seqDB search
MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMG
ELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAAL
KKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVS
DGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERA
VQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN
GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKT
LPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPA
QTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGRE
HGDGSARTLAGR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtctcgctcagaggagatgcaccggctcacggaaaatgtctataagaccatc
atggagcagttcaaccctagcctccggaacttcatcgccatggggaagaattacgagaag
gcactggcaggtgtgacgtatgcagccaaaggctactttgacgccctggtgaagatgggg
gagctggccagcgagagccagggctccaaagaactcggagacgttctcttccagatggct
gaagtccacaggcagatccagaatcagctggaagaaatgctgaagtcttttcacaacgag
ctgcttacgcagctggagcagaaggtggagctggactccaggtatctgagtgctgcgctg
aagaaataccagactgagcaaaggagcaaaggcgacgccctggacaagtgtcaggctgag
ctgaagaagcttcggaagaagagccagggcagcaagaatcctcagaagtactcggacaag
gagctgcagtacatcgacgccatcagcaacaagcagggcgagctggagaattacgtgtcc
gacggctacaagaccgcactgacagaggagcgcaggcgcttctgcttcctggtggagaag
cagtgcgccgtggccaagaactccgcggcctaccactccaagggcaaggagctgctggcg
cagaagctgccgctgtggcaacaggcctgtgccgaccccagcaagatcccggagcgcgcg
gtgcagctcatgcagcaggtggccagcaacggcgccaccctccccagcgccctgtcggcc
tccaagtccaacctggtcatttccgaccccattccgggggccaagcccctgccggtgccc
cccgagctggcaccgttcgtggggcggatgtctgcccaggagagcacacccatcatgaac
ggcgtcacaggcccggatggcgaggactacagcccgtgggctgaccgcaaggctgcccag
cccaaatccctgtctcctccgcagtctcagagcaagctcagcgactcctactccaacaca
ctccccgtgcgcaagagcgtgaccccaaaaaacagctatgccaccaccgagaacaagact
ctgcctcgctcgagctccatggcagccggcctggagcgcaatggccgtatgcgggtgaag
gccatcttctcccacgctgctggggacaacagcaccctcctgagcttcaaggagggtgac
ctcattaccctgctggtgcctgaggcccgcgatggctggcactacggagagagtgagaag
accaagatgcggggctggtttcccttctcctacacccgggtcttggacagcgatggcagt
gacaggctgcacatgagcctgcagcaagggaagagcagcagcacgggcaacctcctggac
aaggacgacctggccatcccaccccccgattacggcgccgcctcccgggccttccccgcc
cagacggccagcggcttcaagcagaggccctacagtgtggccgtgcccgccttctcccag
ggcctggatgactatggagcgcggtccatgagcaggaatccctttgcccacgtccagctg
aagccgacagtgaccaacgacaggtgtgatctgtccgcccaagggccagaaggccgggag
cacggggatgggagcgcccgcaccctggctggaagatga

DBGET integrated database retrieval system