KEGG   Homo sapiens (human): 10459
Entry
10459             CDS       T01001                                 

Gene name
MAD2L2, FANCV, MAD2B, POLZ2, REV7
Definition
(RefSeq) mitotic arrest deficient 2 like 2
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05100  Bacterial invasion of epithelial cells
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00493  Spindle assembly checkpoint signaling
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10459 (MAD2L2)
   04114 Oocyte meiosis
    10459 (MAD2L2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10459 (MAD2L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    10459 (MAD2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10459 (MAD2L2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     10459 (MAD2L2)
SSDB
Motif
Pfam: HORMA
Other DBs
NCBI-GeneID: 10459
NCBI-ProteinID: NP_001120797
OMIM: 604094
HGNC: 6764
Ensembl: ENSG00000116670
Vega: OTTHUMG00000002231
Pharos: Q9UI95(Tbio)
UniProt: Q9UI95 A0A024R4I4
Structure
PDB: 

Position
1p36.22
AA seq 211 aa
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaccacgctcacacgacaagacctcaactttggccaagtggtggccgatgtgctctgc
gagttcctggaggtggctgtgcatctcatcctctacgtgcgcgaggtctaccccgtgggc
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aatcagtatatccaggacacgctgcactgcgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gagatcacccagcctccactgctgtccatcagctcagactcgctgttgtctcatgtggag
cagctgctccgggccttcatcctgaagatcagcgtgtgcgatgccgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagccgccactcgcaacatg
gagaagatccaggtcatcaaggatttcccctggatcctggcggatgagcaggatgtccac
atgcatgacccccggctgataccactaaaaaccatgacgtcggacattttaaagatgcag
ctttacgtggaagagcgcgctcataaaggcagctga

DBGET integrated database retrieval system