KEGG   Homo sapiens (human): 10460
Entry
10460             CDS       T01001                                 

Symbol
TACC3, ERIC-1, ERIC1, Tacc4, maskin
Name
(RefSeq) transforming acidic coiled-coil containing protein 3
  KO
K14283  transforming acidic coiled-coil-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10460 (TACC3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10460 (TACC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     10460 (TACC3)
   mRNA cycle factors
    P-body specific factors
     10460 (TACC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   TACC proteins
    10460 (TACC3)
SSDB
Motif
Pfam: TACC_C Linker_histone DUF3802 RelB_N DUF4776
Other DBs
NCBI-GeneID: 10460
NCBI-ProteinID: NP_006333
OMIM: 605303
HGNC: 11524
Ensembl: ENSG00000013810
Vega: OTTHUMG00000089535
Pharos: Q9Y6A5(Tbio)
UniProt: Q9Y6A5
Structure
PDB: 
5ODT 5LXN 5LXO

Position
4p16.3
AA seq 838 aa
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQK
PVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGG
VCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTLTCAHTSAPE
STAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKRAPPPRRLGER
SGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAE
TPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDY
LEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKL
VEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRS
RCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKDQLTTDLNSMEK
SFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANE
EIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcaatgaaaaaaatacagaaaattgc
gacttcctgttttcgccaccagaagttaccggaagatcgtctgttcttcgtgtgtcacag
aaagaaaatgtgccacccaagaacctggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttcactcaggatgacacccttggactggaaaactcacacccggtctggacacagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaactactcatggaattctacagaaa
ccagtggaggctgacaccgacctcctgggggatgcaagcccagcctttgggagtggcagc
tccagcgagtctggcccaggtgccctggctgacctggactgctcaagctcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccaggaaaagtgtctggcagccctgagcaa
gccgtggaggaaaaccttagttcctattccttagacagaagagtgacacccgcctctgag
accctagaagacccttgcaggacagagtcccagcacaaagcggagactccgcacggagcc
gaggaagaatgcaaagcggagactccgcacggagccgaggaggaatgccggcacggtggg
gtctgtgctcccgcagcagtggccacttcgcctcctggtgcaatccctaaggaagcctgc
ggaggagcacccctgcagggtctgcctggcgaagccctgggctgccctgcgggtgtgggc
acccccgtgccagcagatggcactcagacccttacctgtgcacacacctctgctcctgag
agcacagccccaaccaaccacctggtggctggcagggccatgaccctgagtcctcaggaa
gaagtggctgcaggccaaatggccagctcctcgaggagcggacctgtaaaactagaattt
gatgtatctgatggcgccaccagcaaaagggcacccccaccaaggagactgggagagagg
tccggcctcaagcctcccttgaggaaagcagcagtgaggcagcaaaaggccccgcaggag
gtggaggaggacgacggtaggagcggagcaggagaggacccccccatgccagcttctcgg
ggctcttaccacctcgactgggacaaaatggatgacccaaacttcatcccgttcggaggt
gacaccaagtctggttgcagtgaggcccagcccccagaaagccctgagaccaggctgggc
cagccagcggctgaacagttgcatgctgggcctgccacggaggagccaggtccctgtctg
agccagcagctgcattcagcctcagcggaggacacgcctgtggtgcagttggcagccgag
accccaacagcagagagcaaggagagagccttgaactctgccagcacctcgcttcccaca
agctgtccaggcagtgagccagtgcccacccatcagcaggggcagcctgccttggagctg
aaagaggagagcttcagagaccccgctgaggttctaggcacgggcgcggaggtggattac
ctggagcagtttggaacttcctcgtttaaggagtcggccttgaggaagcagtccttatac
ctcaagttcgaccccctcctgagggacagtcctggtagaccagtgcccgtggccaccgag
accagcagcatgcacggtgcaaatgagactccctcaggacgtccgcgggaagccaagctt
gtggagttcgatttcttgggagcactggacattcctgtgccaggcccacccccaggtgtt
cccgcgcctgggggcccacccctgtccaccggacctatagtggacctgctccagtacagc
cagaaggacctggatgcagtggtaaaggcgacacaggaggagaaccgggagctgaggagc
aggtgtgaggagctccacgggaagaacctggaactggggaagatcatggacaggttcgaa
gaggttgtgtaccaggccatggaggaagttcagaagcagaaggaactttccaaagctgaa
atccagaaagttctaaaagaaaaagaccaacttaccacagatctgaactccatggagaag
tccttctccgacctcttcaagcgttttgagaaacagaaagaggtgatcgagggctaccgc
aagaacgaagagtcactgaagaagtgcgtggaggattacctggcaaggatcacccaggag
ggccagaggtaccaagccctgaaggcccacgcggaggagaagctgcagctggcaaacgag
gagatcgcccaggtccggagcaaggcccaggcggaagcgttggccctccaggccagcctg
aggaaggagcagatgcgcatccagtcgctggagaagacagtggagcagaagactaaagag
aacgaggagctgaccaggatctgcgacgacctcatctccaagatggagaagatctga

DBGET integrated database retrieval system