KEGG   Homo sapiens (human): 10465Help
Entry
10465             CDS       T01001                                 

Gene name
PPIH, CYP-20, CYPH, SnuCyp-20, USA-CYP
Definition
(RefSeq) peptidylprolyl isomerase H
  KO
K09567  peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00354  Spliceosome, U4/U6.U5 tri-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10465 (PPIH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10465 (PPIH)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10465 (PPIH)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     10465 (PPIH)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    10465 (PPIH)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    10465 (PPIH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 10465
NCBI-ProteinID: NP_006338
OMIM: 606095
HGNC: 14651
Ensembl: ENSG00000171960
Vega: OTTHUMG00000007520
Pharos: O43447(Tbio)
UniProt: O43447 Q6FH36
Structure
PDB: 

Position
1p34.2
AA seq 177 aa AA seqDB search
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcaaattcaagtcctgttaaccccgtggtgttctttgatgtcagtattggc
ggtcaggaagttggccgcatgaagatcgagctctttgcagacgttgtgcctaagacggcc
gagaactttaggcagttctgcaccggagaattcaggaaagatggggttccaataggatac
aaaggaagcaccttccacagggtcataaaggatttcatgattcagggtggagattttgtt
aatggagatggtactggagtcgccagtatttaccgggggccatttgcagatgaaaatttt
aaacttagacactcagctccaggcctgctttccatggcgaacagtggtccaagtacaaat
ggctgtcagttctttatcacctgctctaagtgcgattggctggatgggaagcatgtggtg
tttggaaaaatcatcgatggacttctagtgatgagaaagattgagaatgttcccacaggc
cccaacaataagcccaagctacctgtggtgatctcgcagtgtggggagatgtag

DBGET integrated database retrieval system