KEGG   Homo sapiens (human): 10473Help
Entry
10473             CDS       T01001                                 

Gene name
HMGN4, HMG17L3, NHC
Definition
(RefSeq) high mobility group nucleosomal binding domain 4
  KO
K11302  high-mobility group nucleosome-binding domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10473 (HMGN4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    10473 (HMGN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG14_17
Motif
Other DBs
NCBI-GeneID: 10473
NCBI-ProteinID: NP_006344
HGNC: 4989
Ensembl: ENSG00000182952
Vega: OTTHUMG00000014458
Pharos: O00479(Tdark)
UniProt: O00479 A0A024R046
Position
6p22.2
AA seq 90 aa AA seqDB search
MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKA
DAGKDGNNPAKNRDASTLQSQKAEGTGDAK
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagagaaaggcaaaaggagatgctaaaggtgataaagcaaaggtgaaggatgag
ccacagaggagatcagctcggttgtctgctaaaccagctcctccaaaaccagagcccagg
cctaaaaaggcctctgcaaagaagggagagaagcttcccaaagggagaaaggggaaagca
gatgctggaaaggatgggaacaaccctgcaaaaaaccgagatgcctctacactccagtcc
cagaaagcggaaggcactggggatgccaagtga

DBGET integrated database retrieval system