KEGG   Homo sapiens (human): 10474Help
Entry
10474             CDS       T01001                                 

Gene name
TADA3, ADA3, NGG1, STAF54, TADA3L, hADA3
Definition
(RefSeq) transcriptional adaptor 3
  KO
K11315  transcriptional adapter 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Network
nt06130  Cell cycle (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00347  p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    10474 (TADA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10474 (TADA3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10474 (TADA3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     10474 (TADA3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     10474 (TADA3)
    STAGA complex
     10474 (TADA3)
    TFTC complex
     10474 (TADA3)
    SAGA complex
     10474 (TADA3)
    SLIK complex
     10474 (TADA3)
    ADA-HAT complex
     10474 (TADA3)
    HAT-A2 complex
     10474 (TADA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ada3
Motif
Other DBs
NCBI-GeneID: 10474
NCBI-ProteinID: NP_001265199
OMIM: 602945
HGNC: 19422
Ensembl: ENSG00000171148
Vega: OTTHUMG00000128440
Pharos: O75528(Tbio)
UniProt: O75528 A8K899
Position
3p25.3
AA seq 432 aa AA seqDB search
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRR
LRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGR
PKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPP
EDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDAL
LKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPR
NQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHN
RTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTL
KERESILKLLDG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagttgaaagactgccccttgcagttccacgacttcaagtctgtggatcacctg
aaggtctgtccccgctacacggcagtgctggcacgctctgaggatgatggcatcggcatc
gaggagctggacaccctgcagctggagctggagaccctgctgtcttctgccagccggcgc
ctgcgtgtgcttgaggccgaaacccagatcctcaccgactggcaggataagaaaggtgac
agacgattcctgaagctgggtcgagaccatgaacttggagctccccccaaacatgggaag
cccaagaagcagaaactggaagggaaggcaggacatgggccgggccctggcccaggacgg
cccaaatccaaaaaccttcagcccaagatccaggaatatgaattcactgatgaccctatc
gacgtgccacggatccccaaaaatgatgcccccaacaggttctgggcttcagtggagccc
tactgtgctgacatcaccagcgaggaggtccgcacacttgaggagttactgaagccccca
gaagatgaggctgagcattacaagatcccacccctggggaagcactactcccagcgctgg
gcccaggaggacctgctggaggagcagaaggatggggcccgggcagcggctgtggctgac
aagaagaaaggcctcatggggccactgaccgaactggacactaaagatgtggatgccctg
ctgaagaagtctgaggcccagcatgaacagccggaagatggatgcccctttggtgccctg
acgcagcgcctcctgcaggccctggtggaggaaaatattatttcccctatggaggattct
cctattcctgacatgtctgggaaagaatcaggggctgacggggcaagcacctcccctcgc
aatcagaacaagcccttcagtgtgccgcatactaagtccctggagagccgcatcaaggag
gagctaattgcccagggccttttggagtctgaggaccgccccgcagaggactccgaggat
gaggtccttgctgagcttcgcaaacggcaggctgagctgaaggcacttagtgcccacaac
cgcaccaagaagcacgacctgctgaggctggcaaaggaggaggtgagccggcaggagctg
aggcagcgggtgcgcatggctgacaacgaggtcatggacgcctttcgcaagatcatggct
gcccggcagaagaagcggactcccaccaagaaagaaaaggaccaggcctggaagactctg
aaggagcgtgagagcatcctgaagctgctggatgggtag

DBGET integrated database retrieval system