KEGG   Homo sapiens (human): 10476
Entry
10476             CDS       T01001                                 

Gene name
ATP5PD, APT5H, ATP5H, ATPQ
Definition
(RefSeq) ATP synthase peripheral stalk subunit d
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10476 (ATP5PD)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    10476 (ATP5PD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10476 (ATP5PD)
   05012 Parkinson disease
    10476 (ATP5PD)
   05016 Huntington disease
    10476 (ATP5PD)
SSDB
Motif
Pfam: Mt_ATP-synt_D
Other DBs
NCBI-GeneID: 10476
NCBI-ProteinID: NP_006347
OMIM: 618121
HGNC: 845
Ensembl: ENSG00000167863
Vega: OTTHUMG00000179219
Pharos: O75947(Tbio)
UniProt: O75947 A0PJH2
Position
17q25.1
AA seq 161 aa
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKAN
VAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEME
KMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggcgaaaacttgctctaaaaaccattgactgggtagcttttgcagagatcata
ccccagaaccaaaaggccattgctagttccctgaaatcctggaatgagaccctcacctcc
aggttggctgctttacctgagaatccaccagctatcgactgggcttactacaaggccaat
gtggccaaggctggcttggtggatgactttgagaagaagtttaatgcgctgaaggttccc
gtgccagaggataaatatactgcccaggtggatgccgaagaaaaagaagatgtgaaatct
tgtgctgagtgggtgtctctctcaaaggccaggattgtagaatatgagaaagagatggag
aagatgaagaacttaattccatttgatcagatgaccattgaggacttgaatgaagctttc
ccagaaaccaaattagacaagaaaaagtatccctattggcctcaccaaccaattgagaat
ttataa

DBGET integrated database retrieval system