KEGG   Homo sapiens (human): 10476
Entry
10476             CDS       T01001                                 
Symbol
ATP5PD, APT5H, ATP5H, ATPQ
Name
(RefSeq) ATP synthase peripheral stalk subunit d
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10476 (ATP5PD)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    10476 (ATP5PD)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    10476 (ATP5PD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10476 (ATP5PD)
   05012 Parkinson disease
    10476 (ATP5PD)
   05014 Amyotrophic lateral sclerosis
    10476 (ATP5PD)
   05016 Huntington disease
    10476 (ATP5PD)
   05020 Prion disease
    10476 (ATP5PD)
   05022 Pathways of neurodegeneration - multiple diseases
    10476 (ATP5PD)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    10476 (ATP5PD)
SSDB
Motif
Pfam: Mt_ATP-synt_D IclR
Other DBs
NCBI-GeneID: 10476
NCBI-ProteinID: NP_006347
OMIM: 618121
HGNC: 845
Ensembl: ENSG00000167863
Pharos: O75947(Tbio)
UniProt: O75947 A0PJH2
Position
17:complement(75038863..75046969)
AA seq 161 aa
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKAN
VAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEME
KMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggcgaaaacttgctctaaaaaccattgactgggtagcttttgcagagatcata
ccccagaaccaaaaggccattgctagttccctgaaatcctggaatgagaccctcacctcc
aggttggctgctttacctgagaatccaccagctatcgactgggcttactacaaggccaat
gtggccaaggctggcttggtggatgactttgagaagaagtttaatgcgctgaaggttccc
gtgccagaggataaatatactgcccaggtggatgccgaagaaaaagaagatgtgaaatct
tgtgctgagtgggtgtctctctcaaaggccaggattgtagaatatgagaaagagatggag
aagatgaagaacttaattccatttgatcagatgaccattgaggacttgaatgaagctttc
ccagaaaccaaattagacaagaaaaagtatccctattggcctcaccaaccaattgagaat
ttataa

KEGG   Homo sapiens (human): 4508
Entry
4508              CDS       T01001                                 
Symbol
ATP6, ATPase6, MTATP6, MT-ATP6, RP
Name
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H00068  Leber hereditary optic atrophy
H01177  Infantile bilateral striatal necrosis
H01355  Kearns-Sayre syndrome
H01363  NARP syndrome
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4508 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    4508 (ATP6)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4508 (ATP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4508 (ATP6)
   05012 Parkinson disease
    4508 (ATP6)
   05014 Amyotrophic lateral sclerosis
    4508 (ATP6)
   05016 Huntington disease
    4508 (ATP6)
   05020 Prion disease
    4508 (ATP6)
   05022 Pathways of neurodegeneration - multiple diseases
    4508 (ATP6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4508 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4508 (ATP6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    4508 (ATP6)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 4508
NCBI-ProteinID: YP_003024031
OMIM: 516060
HGNC: 7414
Pharos: P00846(Tbio)
UniProt: P00846 Q9B1D3 Q0ZFE3
Position
MT:8527..9207
AA seq 226 aa
MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTM
HNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSK
IKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLA
MSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaacgaaaatctgttcgcttcattcattgcccccacaatcctaggcctacccgccgca
gtactgatcattctatttccccctctattgatccccacctccaaatatctcatcaacaac
cgactaatcaccacccaacaatgactaatcaaactaacctcaaaacaaatgataaccata
cacaacactaaaggacgaacctgatctcttatactagtatccttaatcatttttattgcc
acaactaacctcctcggactcctgcctcactcatttacaccaaccacccaactatctata
aacctagccatggccatccccttatgagcgggcacagtgattataggctttcgctctaag
attaaaaatgccctagcccacttcttaccacaaggcacacctacaccccttatccccata
ctagttattatcgaaaccatcagcctactcattcaaccaatagccctggccgtacgccta
accgctaacattactgcaggccacctactcatgcacctaattggaagcgccaccctagca
atatcaaccattaaccttccctctacacttatcatcttcacaattctaattctactgact
atcctagaaatcgctgtcgccttaatccaagcctacgttttcacacttctagtaagcctc
tacctgcacgacaacacataa

KEGG   Homo sapiens (human): 4509
Entry
4509              CDS       T01001                                 
Symbol
ATP8, ATPase8, MTATP8, MT-ATP8
Name
(RefSeq) ATP synthase F0 subunit 8
  KO
K02125  F-type H+-transporting ATPase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H01355  Kearns-Sayre syndrome
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4509 (ATP8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    4509 (ATP8)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4509 (ATP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4509 (ATP8)
   05012 Parkinson disease
    4509 (ATP8)
   05014 Amyotrophic lateral sclerosis
    4509 (ATP8)
   05016 Huntington disease
    4509 (ATP8)
   05020 Prion disease
    4509 (ATP8)
   05022 Pathways of neurodegeneration - multiple diseases
    4509 (ATP8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4509 (ATP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4509 (ATP8)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    4509 (ATP8)
SSDB
Motif
Pfam: ATP-synt_8
Other DBs
NCBI-GeneID: 4509
NCBI-ProteinID: YP_003024030
OMIM: 516070
HGNC: 7415
Pharos: P03928(Tbio)
UniProt: P03928 A0A1X7RCP4 U5YV54
Position
MT:8366..8572
AA seq 68 aa
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICS
LHSLPPQS
NT seq 207 nt   +upstreamnt  +downstreamnt
atgccccaactaaatactaccgtatggcccaccataattacccccatactccttacacta
ttcctcatcacccaactaaaaatattaaacacaaactaccacctacctccctcaccaaag
cccataaaaataaaaaattataacaaaccctgagaaccaaaatgaacgaaaatctgttcg
cttcattcattgcccccacaatcctag

KEGG   Homo sapiens (human): 498
Entry
498               CDS       T01001                                 
Symbol
ATP5F1A, ATP5A, ATP5A1, ATP5AL2, ATPM, COXPD22, HEL-S-123m, MC5DN4, MOM2, OMR, ORM, hATP1
Name
(RefSeq) ATP synthase F1 subunit alpha
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H00891  Combined oxidative phosphorylation deficiency
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    498 (ATP5F1A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    498 (ATP5F1A)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    498 (ATP5F1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    498 (ATP5F1A)
   05012 Parkinson disease
    498 (ATP5F1A)
   05014 Amyotrophic lateral sclerosis
    498 (ATP5F1A)
   05016 Huntington disease
    498 (ATP5F1A)
   05020 Prion disease
    498 (ATP5F1A)
   05022 Pathways of neurodegeneration - multiple diseases
    498 (ATP5F1A)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    498 (ATP5F1A)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142
Other DBs
NCBI-GeneID: 498
NCBI-ProteinID: NP_001001937
OMIM: 164360
HGNC: 823
Ensembl: ENSG00000152234
Pharos: P25705(Tbio)
UniProt: P25705 V9HW26
Position
18:complement(46080248..46104227)
AA seq 553 aa
MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKL
KEIVTNFLAGFEA
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgctgtccgtgcgcgttgctgcggccgtggtccgcgcccttcctcggcgggccggactg
gtctccagaaatgctttgggttcatctttcattgctgcaaggaacttccatgcctctaac
actcatcttcaaaagactgggactgctgagatgtcctctattcttgaagagcgtattctt
ggagctgatacctctgttgatcttgaagaaactgggcgtgtcttaagtattggtgatggt
attgcccgcgtacatgggctgaggaatgttcaagcagaagaaatggtagagttttcttca
ggcttaaagggtatgtccttgaacttggaacctgacaatgttggtgttgtcgtgtttgga
aatgataaactaattaaggaaggagatatagtgaagaggacaggagccattgtggacgtt
ccagttggtgaggagctgttgggtcgtgtagttgatgcccttggtaatgctattgatgga
aagggtccaattggttccaagacgcgtaggcgagttggtctgaaagcccccggtatcatt
cctcgaatttcagtgcgggaaccaatgcagactggcattaaggctgtggatagcttggtg
ccaattggtcgtggtcagcgtgaactgattattggtgaccgacagactgggaaaacctca
attgctattgacacaatcattaaccagaaacgtttcaatgatggatctgatgaaaagaag
aagctgtactgtatttatgttgctattggtcaaaagagatccactgttgcccagttggtg
aagagacttacagatgcagatgccatgaagtacaccattgtggtgtcggctacggcctcg
gatgctgccccacttcagtacctggctccttactctggctgttccatgggagagtatttt
agagacaatggcaaacatgctttgatcatctatgacgacttatccaaacaggctgttgct
taccgtcagatgtctctgttgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactcccggttgctggagagagcagccaaaatgaacgatgcttttggt
ggtggctccttgactgctttgccagtcatagaaacacaggctggtgatgtgtctgcttac
attccaacaaatgtcatttccatcactgacggacagatcttcttggaaacagaattgttc
tacaaaggtatccgccctgcaattaacgttggtctgtctgtatctcgtgtcggatccgct
gcccaaaccagggctatgaagcaggtagcaggtaccatgaagctggaattggctcagtat
cgtgaggttgctgcttttgcccagttcggttctgacctcgatgctgccactcaacaactt
ttgagtcgtggcgtgcgtctaactgagttgctgaagcaaggacagtattctcccatggct
attgaagaacaagtggctgttatctatgcgggtgtaaggggatatcttgataaactggag
cccagcaagattacaaagtttgagaatgctttcttgtctcatgtcgtcagccagcaccaa
gccttgttgggcactatcagggctgatggaaagatctcagaacaatcagatgcaaagctg
aaagagattgtaacaaatttcttggctggatttgaagcttaa

KEGG   Homo sapiens (human): 506
Entry
506               CDS       T01001                                 
Symbol
ATP5F1B, ATP5B, ATPMB, ATPSB, HEL-S-271
Name
(RefSeq) ATP synthase F1 subunit beta
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    506 (ATP5F1B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    506 (ATP5F1B)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    506 (ATP5F1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    506 (ATP5F1B)
   05012 Parkinson disease
    506 (ATP5F1B)
   05014 Amyotrophic lateral sclerosis
    506 (ATP5F1B)
   05016 Huntington disease
    506 (ATP5F1B)
   05020 Prion disease
    506 (ATP5F1B)
   05022 Pathways of neurodegeneration - multiple diseases
    506 (ATP5F1B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    506 (ATP5F1B)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     506 (ATP5F1B)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 NB-ARC RsgA_GTPase ATPase NACHT AAA_16 AAA_19 DUF5832 ABC_tran DUF2075
Other DBs
NCBI-GeneID: 506
NCBI-ProteinID: NP_001677
OMIM: 102910
HGNC: 830
Ensembl: ENSG00000110955
Pharos: P06576(Tbio)
UniProt: P06576 V9HW31
Position
12:complement(56638175..56645984)
AA seq 529 aa
MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgttggggtttgtgggtcgggtggccgctgctccggcctccggggccttgcggagactc
accccttcagcgtcgctgcccccagctcagctcttactgcgggccgctccgacggcggtc
catcctgtcagggactatgcggcgcaaacatctccttcgccaaaagcaggcgccgccacc
gggcgcatcgtggcggtcattggcgcagtggtggacgtccagtttgatgagggactacca
ccaattctaaatgccctggaagtgcaaggcagggagaccagactggttttggaggtggcc
cagcatttgggtgagagcacagtaaggactattgctatggatggtacagaaggcttggtt
agaggccagaaagtactggattctggtgcaccaatcaaaattcctgttggtcctgagact
ttgggcagaatcatgaatgtcattggagaacctattgatgaaagaggtcccatcaaaacc
aaacaatttgctcccattcatgctgaggctccagagttcatggaaatgagtgttgagcag
gaaattctggtgactggtatcaaggttgtcgatctgctagctccctatgccaagggtggc
aaaattgggctttttggtggtgctggagttggcaagactgtactgatcatggagttaatc
aacaatgtcgccaaagcccatggtggttactctgtgtttgctggtgttggtgagaggacc
cgtgaaggcaatgatttataccatgaaatgattgaatctggtgttatcaacttaaaagat
gccacctctaaggtagcgctggtatatggtcaaatgaatgaaccacctggtgctcgtgcc
cgggtagctctgactgggctgactgtggctgaatacttcagagaccaagaaggtcaagat
gtactgctatttattgataacatctttcgcttcacccaggctggttcagaggtgtctgca
ttattgggccgaatcccttctgctgtgggctatcagcctaccctggccactgacatgggt
actatgcaggaaagaattaccactaccaagaagggatctatcacctctgtacaggctatc
tatgtgcctgctgatgacttgactgaccctgcccctgctactacgtttgcccatttggat
gctaccactgtactgtcgcgtgccattgctgagctgggcatctatccagctgtggatcct
ctagactccacctctcgtatcatggatcccaacattgttggcagtgagcattacgatgtt
gcccgtggggtgcaaaagatcctgcaggactacaaatccctccaggatatcattgccatc
ctgggtatggatgaactttctgaggaagacaagttgaccgtgtcccgtgcacggaaaata
cagcgtttcttgtctcagccattccaggttgctgaggtcttcacaggtcatatggggaag
ctggtacccctgaaggagaccatcaaaggattccagcagattttggcaggtgaatatgac
catctcccagaacaggccttctatatggtgggacccattgaagaagctgtggcaaaagct
gataagctggctgaagagcattcatcgtga

KEGG   Homo sapiens (human): 509
Entry
509               CDS       T01001                                 
Symbol
ATP5F1C, ATP5C, ATP5C1, ATP5CL1
Name
(RefSeq) ATP synthase F1 subunit gamma
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    509 (ATP5F1C)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    509 (ATP5F1C)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    509 (ATP5F1C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    509 (ATP5F1C)
   05012 Parkinson disease
    509 (ATP5F1C)
   05014 Amyotrophic lateral sclerosis
    509 (ATP5F1C)
   05016 Huntington disease
    509 (ATP5F1C)
   05020 Prion disease
    509 (ATP5F1C)
   05022 Pathways of neurodegeneration - multiple diseases
    509 (ATP5F1C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    509 (ATP5F1C)
SSDB
Motif
Pfam: ATP-synt ACT_4
Other DBs
NCBI-GeneID: 509
NCBI-ProteinID: NP_001001973
OMIM: 108729
HGNC: 833
Ensembl: ENSG00000165629
Pharos: P36542(Tbio)
UniProt: P36542 Q8TAS0
Position
10:7788177..7807801
AA seq 298 aa
MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVAT
LTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt   +upstreamnt  +downstreamnt
atgttctctcgcgcgggtgtcgctgggctgtcggcctggaccttgcagccgcaatggatt
caagttcgaaatatggcaactttgaaagatatcaccaggagactaaagtccatcaaaaac
atccagaaaattaccaagtctatgaaaatggtagcggcagcaaaatatgcccgagctgag
agagagctgaaaccagctcgaatatatggattgggatctttagctctgtatgaaaaagct
gatatcaaggggcctgaagacaagaagaaacacctccttattggtgtgtcctcagatcga
ggactgtgtggtgctattcattcctccattgctaaacagatgaaaagcgaggttgctaca
ctaacagcagctgggaaagaagttatgcttgttggaattggtgacaaaatcagaggcata
ctttataggactcattctgaccagtttctggtggcattcaaagaagtgggaagaaagccc
cccacttttggagatgcgtcagtcattgcccttgaattactaaattctggatatgaattt
gatgaaggctccatcatctttaataaattcaggtctgtcatctcctataagacagaagaa
aagcccatcttttcccttaataccgttgcaagtgctgacagcatgagtatctatgacgat
attgatgctgacgtgctgcaaaattaccaagaatacaatctggccaacatcatctactac
tctctgaaggagtccaccactagtgagcagagtgccaggatgacagccatggacaatgcc
agcaagaatgcttctgagatgattgacaaattgacattgacattcaaccgtacccgccaa
gctgtcatcacaaaagagttgattgaaattatctctggtgctgcagctctggattaa

KEGG   Homo sapiens (human): 513
Entry
513               CDS       T01001                                 
Symbol
ATP5F1D, ATP5D, MC5DN5
Name
(RefSeq) ATP synthase F1 subunit delta
  KO
K02134  F-type H+-transporting ATPase subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    513 (ATP5F1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    513 (ATP5F1D)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    513 (ATP5F1D)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    513 (ATP5F1D)
   05012 Parkinson disease
    513 (ATP5F1D)
   05014 Amyotrophic lateral sclerosis
    513 (ATP5F1D)
   05016 Huntington disease
    513 (ATP5F1D)
   05020 Prion disease
    513 (ATP5F1D)
   05022 Pathways of neurodegeneration - multiple diseases
    513 (ATP5F1D)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    513 (ATP5F1D)
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-GeneID: 513
NCBI-ProteinID: NP_001001975
OMIM: 603150
HGNC: 837
Ensembl: ENSG00000099624
Pharos: P30049(Tdark)
UniProt: P30049
Position
19:1241751..1244825
AA seq 168 aa
MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV
PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV
TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgctgcccgccgcgctgctccgccgcccgggacttggccgcctcgtccgccacgcccgt
gcctatgccgaggccgccgccgccccggctgccgcctctggccccaaccagatgtccttc
accttcgcctctcccacgcaggtgttcttcaacggtgccaacgtccggcaggtggacgtg
cccacgctgaccggagccttcggcatcctggcggcccacgtgcccacgctgcaggtcctg
cggccggggctggtcgtggtgcatgcagaggacggcaccacctccaaatactttgtgagc
agcggttccatcgcagtgaacgccgactcttcggtgcagttgttggccgaagaggccgtg
acgctggacatgttggacctgggggcagccaaggcaaacttggagaaggcccaggcggag
ctggtggggacagctgacgaggccacgcgggcagagatccagatccgaatcgaggccaac
gaggccctggtgaaggccctggagtag

KEGG   Homo sapiens (human): 514
Entry
514               CDS       T01001                                 
Symbol
ATP5F1E, ATP5E, ATPE, MC5DN3
Name
(RefSeq) ATP synthase F1 subunit epsilon
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Disease
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    514 (ATP5F1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    514 (ATP5F1E)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    514 (ATP5F1E)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    514 (ATP5F1E)
   05012 Parkinson disease
    514 (ATP5F1E)
   05014 Amyotrophic lateral sclerosis
    514 (ATP5F1E)
   05016 Huntington disease
    514 (ATP5F1E)
   05020 Prion disease
    514 (ATP5F1E)
   05022 Pathways of neurodegeneration - multiple diseases
    514 (ATP5F1E)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    514 (ATP5F1E)
SSDB
Motif
Pfam: ATP-synt_Eps
Other DBs
NCBI-GeneID: 514
NCBI-ProteinID: NP_008817
OMIM: 606153
HGNC: 838
Ensembl: ENSG00000124172
Pharos: P56381(Tbio)
UniProt: P56381
Position
20:complement(59025475..59032335)
AA seq 51 aa
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
NT seq 156 nt   +upstreamnt  +downstreamnt
atggtggcctactggagacaggctggactcagctacatccgatactcccagatctgtgca
aaagcagtgagagatgcactgaagacagaattcaaagcaaatgctgagaagacttctggc
agcaacgtaaaaattgtgaaagtaaagaaggaataa

KEGG   Homo sapiens (human): 515
Entry
515               CDS       T01001                                 
Symbol
ATP5PB, ATP5F1, PIG47
Name
(RefSeq) ATP synthase peripheral stalk-membrane subunit b
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    515 (ATP5PB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    515 (ATP5PB)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    515 (ATP5PB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    515 (ATP5PB)
   05012 Parkinson disease
    515 (ATP5PB)
   05014 Amyotrophic lateral sclerosis
    515 (ATP5PB)
   05016 Huntington disease
    515 (ATP5PB)
   05020 Prion disease
    515 (ATP5PB)
   05022 Pathways of neurodegeneration - multiple diseases
    515 (ATP5PB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    515 (ATP5PB)
SSDB
Motif
Pfam: Mt_ATP-synt_B TraQ DUF2105 TfuA
Other DBs
NCBI-GeneID: 515
NCBI-ProteinID: NP_001679
OMIM: 603270
HGNC: 840
Ensembl: ENSG00000116459
Pharos: P24539(Tbio)
UniProt: P24539 Q08ET0
Position
1:111449464..111462773
AA seq 256 aa
MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFV
ADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEV
TYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCI
ADLKLLAKKAQAQPVM
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctgtcccgggtggtactttccgccgccgccacagcggccccctctctgaagaatgca
gccttcctaggtccaggggtattgcaggcaacaaggacctttcatacagggcagccacac
cttgtccctgtaccacctcttcctgaatacggaggaaaagttcgttatggactgatccct
gaggaattcttccagtttctttatcctaaaactggtgtaacaggaccctatgtactcgga
actgggcttatcttgtacgctttatccaaagaaatatatgtgattagcgcagagaccttc
actgccctatcagtactaggtgtaatggtctatggaattaaaaaatatggtccctttgtt
gcagactttgctgataaactcaatgagcaaaaacttgcccaactagaagaggcgaagcag
gcttccatccaacacatccagaatgcaattgatacggagaagtcacaacaggcactggtt
cagaagcgccattacctttttgatgtgcaaaggaataacattgctatggctttggaagtt
acttaccgggaacgactgtatagagtatataaggaagtaaagaatcgcctggactatcat
atatctgtgcagaacatgatgcgtcgaaaggaacaagaacacatgataaattgggtggag
aagcacgtggtgcaaagcatctccacacagcaggaaaaggagacaattgccaagtgcatt
gcggacctaaagctgctggcaaagaaggctcaagcacagccagttatgtaa

KEGG   Homo sapiens (human): 516
Entry
516               CDS       T01001                                 
Symbol
ATP5MC1, ATP5A, ATP5G, ATP5G1
Name
(RefSeq) ATP synthase membrane subunit c locus 1
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    516 (ATP5MC1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    516 (ATP5MC1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    516 (ATP5MC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    516 (ATP5MC1)
   05012 Parkinson disease
    516 (ATP5MC1)
   05014 Amyotrophic lateral sclerosis
    516 (ATP5MC1)
   05016 Huntington disease
    516 (ATP5MC1)
   05020 Prion disease
    516 (ATP5MC1)
   05022 Pathways of neurodegeneration - multiple diseases
    516 (ATP5MC1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    516 (ATP5MC1)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 516
NCBI-ProteinID: NP_001002027
OMIM: 603192
HGNC: 841
Ensembl: ENSG00000159199
Pharos: P05496(Tbio)
UniProt: P05496 Q6FIH7
Position
17:48892787..48895871
AA seq 136 aa
MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcagaccgccggggcattattcatttctccagctctgatccgctgttgtaccaggggt
ctaatcaggcctgtgtctgcctccttcttgaatagcccagtgaattcatctaaacagcct
tcctacagcaacttcccactccaggtggccagacgggagttccagaccagtgttgtctcc
cgggacattgacacagcagccaagtttattggtgctggggcagccacagttggtgtggct
ggttcaggggctggcattggaaccgtgtttggcagcttgatcattggctatgccaggaac
ccgtctctcaagcagcagctcttctcctatgccattcttggctttgccctgtctgaggcc
atggggcttttctgtttgatggtcgccttcctcatcctcttcgccatgtga

DBGET integrated database retrieval system