KEGG   Homo sapiens (human): 10477Help
Entry
10477             CDS       T01001                                 

Gene name
UBE2E3, UBCH9, UbcM2
Definition
(RefSeq) ubiquitin conjugating enzyme E2 E3
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    10477 (UBE2E3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     10477 (UBE2E3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   10477 (UBE2E3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B RWD UEV
Motif
Other DBs
NCBI-GeneID: 10477
NCBI-ProteinID: NP_001265483
OMIM: 604151
HGNC: 12479
Ensembl: ENSG00000170035
Vega: OTTHUMG00000132585
Pharos: Q969T4(Tbio)
UniProt: Q969T4
Position
2q31.3
AA seq 207 aa AA seqDB search
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
GSIATQYLTNRAEHDRIARQWTKRYAT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgataggcaaaggtccgatgatgagagccccagcaccagcagtggcagttca
gatgcggaccagcgagacccagccgctccagagcctgaagaacaagaggaaagaaaacct
tctgccacccagcagaagaaaaacaccaaactctctagcaaaaccactgctaagttatcc
actagtgctaaaagaattcagaaggagctagctgaaataacccttgatcctcctcctaat
tgcagtgctgggcctaaaggagataacatttatgaatggagatcaactatacttggtcca
ccgggttctgtatatgaaggtggtgtgttttttctggatatcacattttcatcagattat
ccatttaagccaccaaaggttactttccgcaccagaatctatcactgcaacatcaacagt
cagggagtcatctgtctggacatccttaaagacaactggagtcccgctttgactatttca
aaggttttgctgtctatttgttcccttttgacagactgcaaccctgcggatcctctggtt
ggaagcatagccactcagtatttgaccaacagagcagaacacgacaggatagccagacag
tggaccaagagatacgcaacataa

DBGET integrated database retrieval system