KEGG   Homo sapiens (human): 1048Help
Entry
1048              CDS       T01001                                 

Gene name
CEACAM5, CD66e, CEA
Definition
(RefSeq) carcinoembryonic antigen related cell adhesion molecule 5
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Drug target
Arcitumomab: D02977
Cergutuzumab amunaleukin: D10917
Indium (111In) pentetic acid (DG01189): D04524
Labetuzumab: D08936
Technetium (99mTc) arcitumomab: D06028
Yttrium Y 90 labetuzumab: D06350
Yttrium Y 90 labetuzumab tetraxetan: D06351
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1048 (CEACAM5)
  Exosomal proteins of bladder cancer cells
   1048 (CEACAM5)
CD molecules [BR:hsa04090]
 Proteins
  1048 (CEACAM5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  1048 (CEACAM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set Ig_4 Ig_5 Lep_receptor_Ig Podoplanin
Motif
Other DBs
NCBI-GeneID: 1048
NCBI-ProteinID: NP_001278413
OMIM: 114890
HGNC: 1817
Ensembl: ENSG00000105388
Vega: OTTHUMG00000151061
Pharos: P06731(Tbio)
UniProt: P06731 A0A024R0K5 Q53G30
Structure
PDB: 

Position
19q13.2
AA seq 702 aa AA seqDB search
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQ
HLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFY
TLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWV
NNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAP
TISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ
AHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNN
QSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTI
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQAN
NSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQS
LPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISP
PDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNL
ATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggagtctccctcggcccctccccacagatggtgcatcccctggcagaggctcctgctc
acagcctcacttctaaccttctggaacccgcccaccactgccaagctcactattgaatcc
acgccgttcaatgtcgcagaggggaaggaggtgcttctacttgtccacaatctgccccag
catctttttggctacagctggtacaaaggtgaaagagtggatggcaaccgtcaaattata
ggatatgtaataggaactcaacaagctaccccagggcccgcatacagtggtcgagagata
atataccccaatgcatccctgctgatccagaacatcatccagaatgacacaggattctac
accctacacgtcataaagtcagatcttgtgaatgaagaagcaactggccagttccgggta
tacccggagctgcccaagccctccatctccagcaacaactccaaacccgtggaggacaag
gatgctgtggccttcacctgtgaacctgagactcaggacgcaacctacctgtggtgggta
aacaatcagagcctcccggtcagtcccaggctgcagctgtccaatggcaacaggaccctc
actctattcaatgtcacaagaaatgacacagcaagctacaaatgtgaaacccagaaccca
gtgagtgccaggcgcagtgattcagtcatcctgaatgtcctctatggcccggatgccccc
accatttcccctctaaacacatcttacagatcaggggaaaatctgaacctctcctgccac
gcagcctctaacccacctgcacagtactcttggtttgtcaatgggactttccagcaatcc
acccaagagctctttatccccaacatcactgtgaataatagtggatcctatacgtgccaa
gcccataactcagacactggcctcaataggaccacagtcacgacgatcacagtctatgca
gagccacccaaacccttcatcaccagcaacaactccaaccccgtggaggatgaggatgct
gtagccttaacctgtgaacctgagattcagaacacaacctacctgtggtgggtaaataat
cagagcctcccggtcagtcccaggctgcagctgtccaatgacaacaggaccctcactcta
ctcagtgtcacaaggaatgatgtaggaccctatgagtgtggaatccagaacgaattaagt
gttgaccacagcgacccagtcatcctgaatgtcctctatggcccagacgaccccaccatt
tccccctcatacacctattaccgtccaggggtgaacctcagcctctcctgccatgcagcc
tctaacccacctgcacagtattcttggctgattgatgggaacatccagcaacacacacaa
gagctctttatctccaacatcactgagaagaacagcggactctatacctgccaggccaat
aactcagccagtggccacagcaggactacagtcaagacaatcacagtctctgcggagctg
cccaagccctccatctccagcaacaactccaaacccgtggaggacaaggatgctgtggcc
ttcacctgtgaacctgaggctcagaacacaacctacctgtggtgggtaaatggtcagagc
ctcccagtcagtcccaggctgcagctgtccaatggcaacaggaccctcactctattcaat
gtcacaagaaatgacgcaagagcctatgtatgtggaatccagaactcagtgagtgcaaac
cgcagtgacccagtcaccctggatgtcctctatgggccggacacccccatcatttccccc
ccagactcgtcttacctttcgggagcgaacctcaacctctcctgccactcggcctctaac
ccatccccgcagtattcttggcgtatcaatgggataccgcagcaacacacacaagttctc
tttatcgccaaaatcacgccaaataataacgggacctatgcctgttttgtctctaacttg
gctactggccgcaataattccatagtcaagagcatcacagtctctgcatctggaacttct
cctggtctctcagctggggccactgtcggcatcatgattggagtgctggttggggttgct
ctgatatag

DBGET integrated database retrieval system