KEGG   Homo sapiens (human): 10481Help
Entry
10481             CDS       T01001                                 

Gene name
HOXB13, HPC9, PSGD
Definition
(RefSeq) homeobox B13
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HoxA13_N Homeodomain Homeobox_KN DUF1510 CI-B14_5a
Motif
Other DBs
NCBI-GeneID: 10481
NCBI-ProteinID: NP_006352
OMIM: 604607
HGNC: 5112
Ensembl: ENSG00000159184
Vega: OTTHUMG00000159900
Pharos: Q92826(Tbio)
UniProt: Q92826 Q4KR72
Structure
PDB: 

Position
17q21.32
AA seq 284 aa AA seqDB search
MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPP
KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEY
PSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNS
QMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELEREYAANKF
ITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNSATP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggcaattatgccaccttggatggagccaaggatatcgaaggcttgctggga
gcgggaggggggcggaatctggtcgcccactcccctctgaccagccacccagcggcgcct
acgctgatgcctgctgtcaactatgcccccttggatctgccaggctcggcggagccgcca
aagcaatgccacccatgccctggggtgccccaggggacgtccccagctcccgtgccttat
ggttactttggaggcgggtactactcctgccgagtgtcccggagctcgctgaaaccctgt
gcccaggcagccaccctggccgcgtaccccgcggagactcccacggccggggaagagtac
cccagccgccccactgagtttgccttctatccgggatatccgggaacctaccagcctatg
gccagttacctggacgtgtctgtggtgcagactctgggtgctcctggagaaccgcgacat
gactccctgttgcctgtggacagttaccagtcttgggctctcgctggtggctggaacagc
cagatgtgttgccagggagaacagaacccaccaggtcccttttggaaggcagcatttgca
gactccagcgggcagcaccctcctgacgcctgcgcctttcgtcgcggccgcaagaaacgc
attccgtacagcaaggggcagttgcgggagctggagcgggagtatgcggctaacaagttc
atcaccaaggacaagaggcgcaagatctcggcagccaccagcctctcggagcgccagatt
accatctggtttcagaaccgccgggtcaaagagaagaaggttctcgccaaggtgaagaac
agcgctaccccttaa

DBGET integrated database retrieval system