KEGG   Homo sapiens (human): 10484Help
Entry
10484             CDS       T01001                                 

Gene name
SEC23A, CLSD, hSec23A
Definition
(RefSeq) Sec23 homolog A, COPII coat complex component
  KO
K14006  protein transport protein SEC23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01105  Cranio-lenticulo-sutural dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10484 (SEC23A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10484 (SEC23A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10484 (SEC23A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin APP_E2
Motif
Other DBs
NCBI-GeneID: 10484
NCBI-ProteinID: NP_006355
OMIM: 610511
HGNC: 10701
Ensembl: ENSG00000100934
Vega: OTTHUMG00000028812
Pharos: Q15436(Tbio)
UniProt: Q15436
Structure
PDB: 

Position
14q21.1
AA seq 765 aa AA seqDB search
MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVL
CSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLSAKQLQEMLGLSKVPLTQATRGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPTTTLAIYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTIARNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSSFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctatttggaattcattcaacaaaatgaagaacgagatggagtccgatttagt
tggaatgtttggccatcaagtcgactggaagctacaagaatggttgttcctgtggcagcc
ctgtttacaccactgaaagagagacctgacttaccacctattcaatatgaacctgttctg
tgtagtaggaccacttgccgtgcagttttgaatcctttatgtcaagtggattatcgagca
aaactttgggcttgcaacttttgttaccaaaggaatcagtttccacctagttatgctggt
atatctgaactgaatcagcctgctgaacttttacctcagttttctagcattgaatatgta
gttctgcgtggtcctcagatgcctttgatattcctctatgtggttgatacttgcatggaa
gatgaagatttacaagccctgaaagaatccatgcagatgtcattaagtcttttaccacct
acagctttggttggacttattacttttgggagaatggttcaggttcatgaacttggatgt
gaaggcatttcaaaaagctatgtcttcagaggaacaaaagatttgtctgccaaacaactg
caggaaatgctggggctctctaaagtaccacttactcaagcaacacgtggtcctcaggta
cagcagccacctccttccaacagattcttacaaccagtacagaaaatagacatgaatctc
acagatcttctgggagaactccagcgagacccttggcctgtaccacagggaaagagacct
ttgcgttcctctggggtggcactttccatagctgtaggactgctggagtgtacttttccc
aacactggtgctcgtatcatgatgttcattggtggtcctgctactcaggggcctggaatg
gtggttggagatgagttgaagacacctataagatcgtggcatgacattgacaaagacaat
gccaaatatgttaaaaagggaactaagcattttgaagcattggctaatcgagctgctaca
actggccatgttattgatatctatgcgtgtgcattagatcagacaggtctcctggagatg
aaatgctgtcccaaccttactggaggatacatggtaatgggtgattctttcaatacttcc
ttattcaaacaaacttttcaaagagtctttaccaaagacatgcatggacagtttaaaatg
ggctttggtggtacgctagaaataaagacctcaagggaaataaagatttcaggagctatt
ggaccctgtgtgtcactcaattctaaaggaccctgtgtgtctgaaaatgagataggaaca
ggtggcacatgtcagtggaagatatgtggacttagtcccactacaaccttagccatatat
tttgaggttgtcaatcagcataatgctccaattcctcaaggagggcgtggtgcaatccag
tttgtgactcagtatcagcattcaagtgggcagagacgcatccgagtgaccaccattgct
aggaactgggcagatgctcaaactcaaatccaaaacattgctgcatcttttgaccaggag
gcagctgccattcttatggcccggctagcaatatatagagcagaaacagaagaaggtcca
gatgtgcttaggtggctggacagacagctcattcgactgtgtcagaaatttggagaatat
cataaagatgacccaagttccttcagattttcagaaactttctccctttatccacagttt
atgtttcatttaagaagatcttctttcctgcaagtttttaacaatagtcctgatgagagt
tcatattatcgtcaccattttatgcgtcaagatctgacccagtctctaattatgattcag
cctatcctgtatgcgtattcttttagtggaccaccagagccggttcttcttgatagcagt
agcattcttgcagatcgtattcttctcatggacacattcttccagattttgatttatcat
ggtgagaccatagcacagtggcggaagtcaggataccaggatatgcctgagtatgaaaat
ttccgccaccttctgcaagccccagtggatgatgcacaggaaattcttcactccagattt
ccaatgccaagatacattgacactgaacatggaggcagccaggcccgtttcctcctttca
aaagtcaacccttcacagactcataataatatgtatgcctgggggcaggagtctggagca
cctattcttacagatgatgttagtttacaagtgtttatggatcacttgaagaaacttgct
gtgtccagtgctgcttga

DBGET integrated database retrieval system