KEGG   Homo sapiens (human): 10488Help
Entry
10488             CDS       T01001                                 

Gene name
CREB3, LUMAN, LZIP, sLZIP
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00510  HTLV-1 Tax to CREB-mediated transcription
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    10488 (CREB3)
   04024 cAMP signaling pathway
    10488 (CREB3)
   04022 cGMP-PKG signaling pathway
    10488 (CREB3)
   04151 PI3K-Akt signaling pathway
    10488 (CREB3)
   04152 AMPK signaling pathway
    10488 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    10488 (CREB3)
   04922 Glucagon signaling pathway
    10488 (CREB3)
   04915 Estrogen signaling pathway
    10488 (CREB3)
   04926 Relaxin signaling pathway
    10488 (CREB3)
   04918 Thyroid hormone synthesis
    10488 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    10488 (CREB3)
   04916 Melanogenesis
    10488 (CREB3)
   04925 Aldosterone synthesis and secretion
    10488 (CREB3)
   04927 Cortisol synthesis and secretion
    10488 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10488 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10488 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    10488 (CREB3)
   04728 Dopaminergic synapse
    10488 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    10488 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    10488 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    10488 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    10488 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    10488 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    10488 (CREB3)
   05031 Amphetamine addiction
    10488 (CREB3)
   05034 Alcoholism
    10488 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    10488 (CREB3)
   04934 Cushing syndrome
    10488 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10488 (CREB3)
   05161 Hepatitis B
    10488 (CREB3)
   05163 Human cytomegalovirus infection
    10488 (CREB3)
   05165 Human papillomavirus infection
    10488 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10488 (CREB3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    10488 (CREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 10488
NCBI-ProteinID: NP_006359
OMIM: 606443
HGNC: 2347
Ensembl: ENSG00000107175
Vega: OTTHUMG00000019872
Pharos: O43889(Tbio)
UniProt: O43889
Position
9p13.3
AA seq 371 aa AA seqDB search
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaattggatgctggtgaccaagacctgctggccttcctgctagaggaaagt
ggagatttggggacggcacccgatgaggccgtgagggccccactggactgggcgctgccg
ctttctgaggtaccgagcgactgggaagtagatgatttgctgtgctccctgctgagtccc
ccagcgtcgttgaacattctcagctcctccaacccctgccttgtccaccatgaccacacc
tactccctcccacgggaaactgtctctatggatctagagagtgagagctgtagaaaagag
gggacccagatgactccacagcatatggaggagctggcagagcaggagattgctaggcta
gtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgagaca
cttcctctcactaagacagaggaacaaattctgaaacgtgtgcggaggaagattcgaaat
aaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagagagc
agggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagcttctggag
gaacagaatttgtcccttctagatcaactgaggaaactccaggccatggtgattgagata
tcaaacaaaaccagcagcagcagcacctgcatcttggtcctactagtctccttctgcctc
ctccttgtacctgctatgtactcctctgacacaagggggagcctgccagctgagcatgga
gtgttgtcccgccagcttcgtgccctccccagtgaggacccttaccagctggagctgcct
gccctgcagtcagaagtgccgaaagacagcacacaccagtggttggacggctcagactgt
gtactccaggcccctggcaacacttcctgcctgctgcattacatgcctcaggctcccagt
gcagagcctcccctggagtggccattccctgacctcttctcagagcctctctgccgaggt
cccatcctccccctgcaggcaaatctcacaaggaagggaggatggcttcctactggtagc
ccctctgtcattttgcaggacagatactcaggctag

KEGG   Homo sapiens (human): 1385Help
Entry
1385              CDS       T01001                                 

Gene name
CREB1, CREB, CREB-1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04380  Osteoclast differentiation
hsa04612  Antigen processing and presentation
hsa04668  TNF signaling pathway
hsa04710  Circadian rhythm
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    1385 (CREB1)
   04024 cAMP signaling pathway
    1385 (CREB1)
   04022 cGMP-PKG signaling pathway
    1385 (CREB1)
   04151 PI3K-Akt signaling pathway
    1385 (CREB1)
   04152 AMPK signaling pathway
    1385 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    1385 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    1385 (CREB1)
   04922 Glucagon signaling pathway
    1385 (CREB1)
   04915 Estrogen signaling pathway
    1385 (CREB1)
   04926 Relaxin signaling pathway
    1385 (CREB1)
   04918 Thyroid hormone synthesis
    1385 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    1385 (CREB1)
   04916 Melanogenesis
    1385 (CREB1)
   04924 Renin secretion
    1385 (CREB1)
   04925 Aldosterone synthesis and secretion
    1385 (CREB1)
   04927 Cortisol synthesis and secretion
    1385 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1385 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1385 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    1385 (CREB1)
   04728 Dopaminergic synapse
    1385 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1385 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    1385 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    1385 (CREB1)
   04713 Circadian entrainment
    1385 (CREB1)
   04714 Thermogenesis
    1385 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1385 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    1385 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    1385 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    1385 (CREB1)
   05031 Amphetamine addiction
    1385 (CREB1)
   05034 Alcoholism
    1385 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    1385 (CREB1)
   04934 Cushing syndrome
    1385 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    1385 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1385 (CREB1)
   05161 Hepatitis B
    1385 (CREB1)
   05163 Human cytomegalovirus infection
    1385 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1385 (CREB1)
   05165 Human papillomavirus infection
    1385 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1385 (CREB1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    1385 (CREB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    1385 (CREB1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    1385 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5
Motif
Other DBs
NCBI-GeneID: 1385
NCBI-ProteinID: NP_604391
OMIM: 123810
HGNC: 2345
Ensembl: ENSG00000118260
Vega: OTTHUMG00000132936
Pharos: P16220(Tbio)
UniProt: P16220 Q5U0J5
Structure
PDB: 

Position
2q33.3
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagcagccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Homo sapiens (human): 148327Help
Entry
148327            CDS       T01001                                 

Gene name
CREB3L4, AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
Definition
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    148327 (CREB3L4)
   04024 cAMP signaling pathway
    148327 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    148327 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    148327 (CREB3L4)
   04152 AMPK signaling pathway
    148327 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    148327 (CREB3L4)
   04922 Glucagon signaling pathway
    148327 (CREB3L4)
   04915 Estrogen signaling pathway
    148327 (CREB3L4)
   04926 Relaxin signaling pathway
    148327 (CREB3L4)
   04918 Thyroid hormone synthesis
    148327 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    148327 (CREB3L4)
   04916 Melanogenesis
    148327 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    148327 (CREB3L4)
   04927 Cortisol synthesis and secretion
    148327 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    148327 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    148327 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    148327 (CREB3L4)
   04728 Dopaminergic synapse
    148327 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    148327 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    148327 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    148327 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    148327 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    148327 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    148327 (CREB3L4)
   05031 Amphetamine addiction
    148327 (CREB3L4)
   05034 Alcoholism
    148327 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    148327 (CREB3L4)
   04934 Cushing syndrome
    148327 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    148327 (CREB3L4)
   05161 Hepatitis B
    148327 (CREB3L4)
   05163 Human cytomegalovirus infection
    148327 (CREB3L4)
   05165 Human papillomavirus infection
    148327 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    148327 (CREB3L4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    148327 (CREB3L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 ATG16 OppC_N APG6_N EMP24_GP25L HAUS-augmin3 KASH_CCD HALZ JMY DUF1664 MCU DUF2207 YabA Jnk-SapK_ap_N
Motif
Other DBs
NCBI-GeneID: 148327
NCBI-ProteinID: NP_001242907
OMIM: 607138
HGNC: 18854
Ensembl: ENSG00000143578
Vega: OTTHUMG00000037159
Pharos: Q8TEY5(Tbio)
UniProt: Q8TEY5
Position
1q21.3
AA seq 395 aa AA seqDB search
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacgcgtggctggagcccccagaggatatcttc
tcgacaggatccgtcctggagctgggactccactgcccccctccagaggttccggtaact
aggctacaggaacagggactgcaaggctggaagtccggtggggaccgtggctgtggcctt
caagagagtgagcctgaagatttcttgaagcttttcattgatcccaatgaggtgtactgc
tcagaagcatctcctggcagtgacagtggcatctctgaggacccctgccatccagacagt
ccccctgcccccagggcaaccagttctcctatgctctatgaggttgtctatgaggcaggg
gccctggagaggatgcagggggaaactgggccaaatgtaggccttatctccatccagcta
gatcagtggagcccagcatttatggtgcctgattcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcctgcccagagcaggcaccgtagccccagtgccctgtacaacc
ctgctgccctgtcaaaccctgttcctgaccgatgaggagaagcgtctgctggggcaggaa
ggggtttccctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaacatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagctgcccagaccagcacttgtgttttgatt
cttcttttttccctggctctcatcatcctgcccagcttcagtccattccagagtcgacca
gaagctgggtctgaggattaccagcctcacggagtgacttccagaaatatcctgacccac
aaggacgtaacagaaaatctggagacccaagtggtagagtccagactgagggagccacct
ggagccaaggatgcaaatggctcaacaaggacactgcttgagaagatgggagggaagcca
agacccagtgggcgcatccggtccgtgctgcatgcagatgagatgtga

KEGG   Homo sapiens (human): 64764Help
Entry
64764             CDS       T01001                                 

Gene name
CREB3L2, BBF2H7
Definition
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64764 (CREB3L2)
   04024 cAMP signaling pathway
    64764 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    64764 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    64764 (CREB3L2)
   04152 AMPK signaling pathway
    64764 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    64764 (CREB3L2)
   04922 Glucagon signaling pathway
    64764 (CREB3L2)
   04915 Estrogen signaling pathway
    64764 (CREB3L2)
   04926 Relaxin signaling pathway
    64764 (CREB3L2)
   04918 Thyroid hormone synthesis
    64764 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    64764 (CREB3L2)
   04916 Melanogenesis
    64764 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    64764 (CREB3L2)
   04927 Cortisol synthesis and secretion
    64764 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64764 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    64764 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    64764 (CREB3L2)
   04728 Dopaminergic synapse
    64764 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    64764 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    64764 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    64764 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    64764 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    64764 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    64764 (CREB3L2)
   05031 Amphetamine addiction
    64764 (CREB3L2)
   05034 Alcoholism
    64764 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    64764 (CREB3L2)
   04934 Cushing syndrome
    64764 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64764 (CREB3L2)
   05161 Hepatitis B
    64764 (CREB3L2)
   05163 Human cytomegalovirus infection
    64764 (CREB3L2)
   05165 Human papillomavirus infection
    64764 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    64764 (CREB3L2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    64764 (CREB3L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS-augmin3 JMY
Motif
Other DBs
NCBI-GeneID: 64764
NCBI-ProteinID: NP_919047
OMIM: 608834
HGNC: 23720
Ensembl: ENSG00000182158
Vega: OTTHUMG00000155744
Pharos: Q70SY1(Tbio)
UniProt: Q70SY1 Q68D60
Position
7q33
AA seq 520 aa AA seqDB search
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgatcctttcctctcagagaag
agtgtgtcaatggaggtggaaccttccccgacgtccccggcgcctctcatccaggctgag
cacagctactccctgtgcgaggagcctcgggcccagtcgcccttcacccacattaccacc
agtgacagcttcaatgacgatgaggtggaaagtgagaaatggtacctgtctacagacttc
ccttcaacatccatcaagacagagccagttacagacgaaccacccccaggactcgttccg
tctgtcactctgaccatcacagccatctccaccccgttggaaaaggaggaacctcctctg
gaaatgaacactggggttgattcctcgtgccagaccattattcctaaaattaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagccccagtggaccacctg
catttgccgcccacccctccgagcagtcacggcagtgactcagagggcagcctgagtccc
aacccacgcctgcaccccttcagcctgcctcagacccacagcccctccagagctgcaccc
cgggccccctccgccctctccagctcccctctcctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacagaggaggagaagaggaccctgatcgctgagggctatccc
atccccaccaaattgcccctgtcaaaatcagaggagaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgctcaggaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttctagagaacactaataggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagctggcacgcagactggcacctgcctc
atggttgtggtgctgtgctttgccgttgcattcggcagcttctttcaaggctacgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaggagccctacaca
gcctccgtggtgagatccagaaacctgctgatctacgaggaacattctcccccagaggag
tcatccagcccgggctcggctggggagctggggggctgggatagaggttcctccctgctc
agggtgtcagggctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgcttttggagctgcagcagcacctggtcagcgccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

KEGG   Homo sapiens (human): 84699Help
Entry
84699             CDS       T01001                                 

Gene name
CREB3L3, CREB-H, CREBH, HYST1481
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    84699 (CREB3L3)
   04024 cAMP signaling pathway
    84699 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    84699 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    84699 (CREB3L3)
   04152 AMPK signaling pathway
    84699 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    84699 (CREB3L3)
   04922 Glucagon signaling pathway
    84699 (CREB3L3)
   04915 Estrogen signaling pathway
    84699 (CREB3L3)
   04926 Relaxin signaling pathway
    84699 (CREB3L3)
   04918 Thyroid hormone synthesis
    84699 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    84699 (CREB3L3)
   04916 Melanogenesis
    84699 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    84699 (CREB3L3)
   04927 Cortisol synthesis and secretion
    84699 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    84699 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    84699 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    84699 (CREB3L3)
   04728 Dopaminergic synapse
    84699 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    84699 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    84699 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    84699 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    84699 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    84699 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    84699 (CREB3L3)
   05031 Amphetamine addiction
    84699 (CREB3L3)
   05034 Alcoholism
    84699 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    84699 (CREB3L3)
   04934 Cushing syndrome
    84699 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    84699 (CREB3L3)
   05161 Hepatitis B
    84699 (CREB3L3)
   05163 Human cytomegalovirus infection
    84699 (CREB3L3)
   05165 Human papillomavirus infection
    84699 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    84699 (CREB3L3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    84699 (CREB3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf KASH_CCD DUF2207
Motif
Other DBs
NCBI-GeneID: 84699
NCBI-ProteinID: NP_115996
OMIM: 611998
HGNC: 18855
Ensembl: ENSG00000060566
Vega: OTTHUMG00000181846
Pharos: Q68CJ9(Tbio)
UniProt: Q68CJ9
Position
19p13.3
AA seq 461 aa AA seqDB search
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV
KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS
RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggatttagctgctggaaagatggcttctgctgcctgctccatggaccccatc
gacagctttgagctcctggatctcctgtttgaccggcaggacggcatcctgagacacgtg
gagctgggcgagggctggggtcacgtcaaggaccagcaggtcctgccaaaccccgactct
gacgacttcctcagctccatcctgggctctggagactcactgcccagctccccactctgg
tcccccgaaggcagtgatagtggcatctccgaagacctcccctccgacccccaggacacc
cctccacgcagcggaccagccacctcccccgccggctgccatcctgcccagcctggcaag
gggccctgcctctcctatcatcctggcaactcttgctccaccacaaccccagggccagtg
atccaagtacctgaagcctctgtgaccatagacctggaaatgtggagcccaggaggaagg
atctgtgctgagaagccggctgatccggtggacctgtccccacgatgcaatctcaccgtg
aaagacctcctcctttcgggcagcagtggggacctgcaacagcatcacctgggggcctcc
tacctcctgcgacctggggctgggcactgtcaggagctggtgctcaccgaggatgagaag
aagctgctggctaaagaaggcatcaccctgcccactcagctgcccctcactaagtacgag
gagcgagtgctgaaaaaaatccgccggaaaatccggaacaagcagtcggcgcaagaaagc
aggaagaagaagaaggaatatatcgatggcctggagactcggatgtcagcttgcactgct
cagaatcaggagttacagaggaaagtcttgcatctcgagaagcaaaacctgtccctcttg
gagcaactgaagaaactccaggccattgtggtgcagtccaccagcaagtcagcccagaca
ggcacctgtgtcgcagtcctgttgctgtcctttgccctcatcatcctcccctccatcagc
ccttttggccccaacaaaaccgagagccctggggactttgcgcctgtacgagtgttctcc
agaactttgcacaacgatgctgcctcccgcgtggctgctgatgctgtgccaggctccgag
gccccaggaccccgacccgaggctgacacaacccgagaagagtctccaggaagccccggg
gcagactggggcttccaggacaccgcgaacctgaccaattcgacggaggagctggacaac
gccaccctggtcctgaggaatgcaacagaggggctgggccaggtcgccctgctggactgg
gtggcgcctgggccgagcactggctcaggacgtgcagggctggaggcggcgggagacgag
ctgtga

KEGG   Homo sapiens (human): 90993Help
Entry
90993             CDS       T01001                                 

Gene name
CREB3L1, OASIS, OI16
Definition
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Disease
H00506  Osteogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    90993 (CREB3L1)
   04024 cAMP signaling pathway
    90993 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    90993 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    90993 (CREB3L1)
   04152 AMPK signaling pathway
    90993 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    90993 (CREB3L1)
   04922 Glucagon signaling pathway
    90993 (CREB3L1)
   04915 Estrogen signaling pathway
    90993 (CREB3L1)
   04926 Relaxin signaling pathway
    90993 (CREB3L1)
   04918 Thyroid hormone synthesis
    90993 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    90993 (CREB3L1)
   04916 Melanogenesis
    90993 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    90993 (CREB3L1)
   04927 Cortisol synthesis and secretion
    90993 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    90993 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    90993 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    90993 (CREB3L1)
   04728 Dopaminergic synapse
    90993 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    90993 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    90993 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    90993 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    90993 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    90993 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    90993 (CREB3L1)
   05031 Amphetamine addiction
    90993 (CREB3L1)
   05034 Alcoholism
    90993 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    90993 (CREB3L1)
   04934 Cushing syndrome
    90993 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    90993 (CREB3L1)
   05161 Hepatitis B
    90993 (CREB3L1)
   05163 Human cytomegalovirus infection
    90993 (CREB3L1)
   05165 Human papillomavirus infection
    90993 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    90993 (CREB3L1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    90993 (CREB3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 HAUS-augmin3 JMY APG6_N TPR_MLP1_2 Jnk-SapK_ap_N DUF3552 DUF4404 ADIP
Motif
Other DBs
NCBI-GeneID: 90993
NCBI-ProteinID: NP_443086
OMIM: 616215
HGNC: 18856
Ensembl: ENSG00000157613
Vega: OTTHUMG00000166423
Pharos: Q96BA8(Tbio)
UniProt: Q96BA8 B2RA75
Position
11p11.2
AA seq 519 aa AA seqDB search
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMAAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPLEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPLAADGVYTASQM
PSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcttggaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgcgcactttcctgagcacctg
gaccactttacggagaacatggaggacttctccaatgacctgttcagcagcttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactcccctacgcca
ggcatccaggcggagcacagctactccctgagcggcgactcagcgccccagagccccctt
gtgcccatcaagatggaggacaccacccaagatgcagagcatggagcatgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgccccctcggccatggctgccgcggccgccatggccaccaccccgctgctgggc
ctcagccccttgtccaggctgcccatcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaagcagagcctctggaggtgaaccagttcctcaaagtgacaccggaggac
ctggtgcagatgcctccgacgccccccagcagccatggcagtgacagcgacggctcccag
agtccccgctctctgcccccctccagccctgtcaggcccatggcgcgctcctccacggcc
atctccacctccccactcctcactgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcggaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagccgaggagaaggccttgaagagagtccggaggaaaatcaagaac
aagatctcagcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatctgagaacaatgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcccgagttctcctccggc
tcccagactgtgaaggaagaccccctggccgcagacggcgtctacacggccagccagatg
ccctcccgaagcctcctattctacgatgacggggcaggcttatgggaagatggccgcagc
accctgctgcccatggagcccccagatggctgggaaatcaaccccggggggccggcagag
cagcggccccgggaccacctgcagcatgatcacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggcctaaagacggtggaaacggcaccagccccgacttctcccac
tccaaggagtggttccacgacagggatctgggccccaacaccaccatcaaactctcctag

KEGG   Homo sapiens (human): 9586Help
Entry
9586              CDS       T01001                                 

Gene name
CREB5, CRE-BPA, CREB-5, CREBPA
Definition
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
nt06123  TNF signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TSH-TG/TH-THR signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    9586 (CREB5)
   04024 cAMP signaling pathway
    9586 (CREB5)
   04022 cGMP-PKG signaling pathway
    9586 (CREB5)
   04151 PI3K-Akt signaling pathway
    9586 (CREB5)
   04152 AMPK signaling pathway
    9586 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    9586 (CREB5)
   04922 Glucagon signaling pathway
    9586 (CREB5)
   04915 Estrogen signaling pathway
    9586 (CREB5)
   04926 Relaxin signaling pathway
    9586 (CREB5)
   04918 Thyroid hormone synthesis
    9586 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    9586 (CREB5)
   04925 Aldosterone synthesis and secretion
    9586 (CREB5)
   04927 Cortisol synthesis and secretion
    9586 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    9586 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    9586 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    9586 (CREB5)
   04728 Dopaminergic synapse
    9586 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    9586 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    9586 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    9586 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    9586 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    9586 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    9586 (CREB5)
   05031 Amphetamine addiction
    9586 (CREB5)
   05034 Alcoholism
    9586 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    9586 (CREB5)
   04934 Cushing syndrome
    9586 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9586 (CREB5)
   05161 Hepatitis B
    9586 (CREB5)
   05163 Human cytomegalovirus infection
    9586 (CREB5)
   05165 Human papillomavirus infection
    9586 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9586 (CREB5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    9586 (CREB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 GIT_CC DUF3874 DivIC
Motif
Other DBs
NCBI-GeneID: 9586
NCBI-ProteinID: NP_878901
OMIM: 618262
HGNC: 16844
Ensembl: ENSG00000146592
Vega: OTTHUMG00000097081
Pharos: Q02930(Tbio)
UniProt: Q02930
Position
7p15.1
AA seq 508 aa AA seqDB search
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccgtttgtctgcagtgcc
ccaggctgctcccagcgcttcccaacagaggaccatctgatgattcataggcacaaacat
gaaatgactttgaagtttccttcaataaaaacagacaatatgttatcagatcaaactccg
accccaacgagattcctgaagaactgcgaggaggtgggcctcttcagcgagctggactgc
tccctggagcacgagttcaggaaggctcaggaagaggagagcagcaagcggaatatctcg
atgcataatgcagttggtggggccatgacggggcccggaactcaccagcttagcagcgct
cggctgcccaaccatgacaccaacgttgtgattcagcaagccatgccgtcgcctcagtcc
agctctgtcatcactcaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatctccacaacagacagagacagcccatgccagcctccatgcct
gggaccctgcccaaccctacaatgccaggatcttccgccgtcttgatgccaatggagcga
caaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccctgt
gcttctccccaggtccagccaatgcattcagaagccaaaatgaggttgaaggctgcattg
actcaccaccctgctgccatgtcaaatgggaacatgaacaccatgggacacatgatggag
atgatgggctcccggcaggaccagacgccacaccatcacatgcactcgcacccgcatcag
caccagacactgccaccccatcacccttacccacaccagcaccagcacccagcacaccat
cctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccacctt
catgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccggcaaccaa
gcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccaccccag
cccacaggggggcgccggcgaagggtggtagacgaggatccggacgagaggcggcggaaa
tttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgggtg
atgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaatgaa
gtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaagac
tgcccaataacagccatgcagaaagaatcacaaggatatctaagtccagagagtagccct
cctgctagtcctgtcccagcttgctcccagcaacaagtcatccagcataataccatcact
acttcctcatcggtcagcgaggtggtaggaagctccaccctcagccagctcaccactcac
agaacagacctgaatccgattctttaa

DBGET integrated database retrieval system