KEGG   Homo sapiens (human): 104909134
Entry
104909134         CDS       T01001                                 

Gene name
CRHR1-IT1-CRHR1, MGC57346-CRHR1
Definition
(RefSeq) LINC02210-CRHR1 readthrough
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: 7tm_2
Other DBs
NCBI-GeneID: 104909134
NCBI-ProteinID: NP_001289945
HGNC: 51483
Ensembl: ENSG00000263715
Vega: OTTHUMG00000178270
UniProt: P34998 B4DMR5
Position
17q21.31
AA seq 285 aa
MVSATIPQKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISA
FILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTY
STDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLL
INFIFLFNIVRILMTKLRASTTSETIQYRASLCLCSTVSSIVRSVLPSGRGGTGGRTSTR
SVPEWPVPCPSPPPQPVSAFTASSSPQQSELAGHGAAPKELWLGG
NT seq 858 nt   +upstreamnt  +downstreamnt
atggtgtccgctacaataccacaaaaaaaaagcaaggtgcactaccatgtcgcagtcatc
atcaactacctgggccactgtatctccctggtggccctcctggtggcctttgtcctcttt
ctgcggctcaggagcatccggtgcctgcgaaacatcatccactggaacctcatctccgcc
ttcatcctgcgcaacgccacctggttcgtggtccagctaaccatgagccccgaggtccac
cagagcaacgtgggctggtgcaggttggtgacagccgcctacaactacttccatgtgacc
aacttcttctggatgttcggcgagggctgctacctgcacacagccatcgtgctcacctac
tccactgaccggctgcgcaaatggatgttcatctgcattggctggggtgtgcccttcccc
atcattgtggcctgggccattgggaagctgtactacgacaatgagaagtgctggtttggc
aaaaggcctggggtgtacaccgactacatctaccagggccccatgatcctggtcctgctg
atcaatttcatcttccttttcaacatcgtccgcatcctcatgaccaagctccgggcatcc
accacgtctgagaccattcagtacagggcttctttgtgtctgtgttctactgtttcctca
atagtgaggtccgttctgccatccggaagaggtggcaccggtggcaggacaagcactcga
tccgtgcccgagtggcccgtgccatgtccatccccacctccccaacccgtgtcagctttc
acagcatcaagcagtccacagcagtctgagctggcaggtcatggagcagcccccaaagag
ctgtggctggggggatga

DBGET integrated database retrieval system