KEGG   Homo sapiens (human): 10497Help
Entry
10497             CDS       T01001                                 

Gene name
UNC13B, MUNC13, UNC13, Unc13h2
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  protein unc-13 A/B/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10497 (UNC13B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10497 (UNC13B)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10497 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1
Motif
Other DBs
NCBI-GeneID: 10497
NCBI-ProteinID: NP_006368
OMIM: 605836
HGNC: 12566
Ensembl: ENSG00000198722
Vega: OTTHUMG00000019856
Pharos: O14795(Tbio)
UniProt: O14795 Q4LE73
Position
9p13.3
AA seq 1591 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcgctgaagactattcgtcagtcggatgaggaagggcctggggaatggtccacattagag
gcagagacgttaatgaaagacgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccagaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgccgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcttccca
cctccttaccatacagcttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
cgatcgccacagcagctgctacttcaaggcagttcccgggactcttgtaatgactctatg
caaagttatgaccttgattatccagagcggcgggctatcagccccaccagcagcagtagg
tatggctcctcctgtaatgtgagtcaaggaagctctcagctaagtgaactagaccagtat
cacgaacaagatgacgaccatcgggagacggactcgattcattcttgccacagctctcac
agcctgtccagagatggccaagcaggttttggagaacaagagaaacccttggaggtgaca
ggtcaagcagagaaggaggcagcatgtgaacccaaggagatgaaagaagatgccacaacc
caccctcccccagatctggtgctgcaaaaagaccacttcctaggtccccaggagagtttt
cctgaggagaatgcatcttcaccatttacccaagccagagcacattggatccgagcagtt
accaaggttcgactccagctgcaggagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctgtcactggtccagtctcggaaggcagga
atcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcccacgtg
tataagaaaaccctgcaggccttaatctaccccatttcgtgcaccactcctcataacttt
gaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctctggggc
attgcccggcagggcatgcgctgcagcgaatgtggagtcaagtgccatgagaagtgccag
gatctgctcaatgctgactgcctgcagcgggctgcagaaaagagctgtaaacatggagct
gaggaccggacccagaacattatcatggccatgaaggaccgcatgaagatccgagagcga
aataagccagagatctttgaagttatccgggacgtcttcacagtgaacaaagctgcccat
gtgcagcagatgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcagcc
aagatcaccattactgtggtgtgtgcccagggcctacaagccaaggacaaaacaggatcc
agtgacccttacgtgactgtgcaagtcagcaaaactaagaagcgtaccaagaccattttt
ggaaacttgaatcctgtttgggaggagaagttccattttgagtgccacaactcctctgac
cgcattaaggtgcgtgtatgggatgaggatgatgacatcaagtcaagagtaaagcaacgc
ctaaagcgagagtctgatgatttccttggccaaaccatcattgaggttcggaccctaagt
ggcgagatggacgtctggtacaacttggagaagaggacagacaaatcagccgtctcaggg
gctatccgactacaaatcagtgtggagatcaagggggaggagaaagtagccccataccac
gtgcagtatacatgtctccatgagaatcttttccattacctcacagacattcagggcagt
ggaggagtccgcatccctgaagctcgaggagacgatgcctggaaggtgtactttgatgag
acagcccaagaaattgtggatgaatttgccatgcgttatggcattgagtccatatatcag
gccatgacgcactttgcatgtttatcatccaagtacatgtgtcctggtgtgccagcagtg
atgagcaccttactggccaacatcaacgcctactatgcccacacaactgcctctaccaat
gtctctgcatctgatcgctttgcagcctccaactttgggaaagagagatttgtaaaactg
ctggaccagctacacaactcactgaggatcgacctctctacatacaggaataatttccct
gctgggagtcctgaacggcttcaggacttaaaatccacagtggatttgctgaccagcatt
actttcttcagaatgaaggtacaagaactgcaaagccctccaagagccagccaggtggta
aaggattgtgtgaaggcctgtttgaactccacatatgaatatatcttcaacaactgccac
gacttatacagccgccagtaccagctgaagcaggagctacctccagaggaacaagggccc
agcattcggaacctggatttctggcccaagctcatcacactcatcgtgtcaatcatagag
gaagataagaattcctacacacctgttctgaaccagtttcctcaggagttgaatgtggga
aaagtcagcgcagaagtgatgtggcatttgtttgcccaagacatgaaatatgcattggag
gagcatgagaaagaccacctgtgtaaaagtgctgactacatgaacctgcacttcaaggtg
aagtggctccacaatgaatacgtgcgggatctgcctgtcctccaggggcaggtgcctgag
tacccagcgtggtttgagcagttcgtgctacaatggctggatgagaatgaggatgtatcc
ctggaattcctgcgtggggccctggaacgagataagaaggatggattccagcagacatca
gagcatgcactcttttcctgctctgtggtggatgtcttcacacaactcaatcagagcttt
gagatcatccggaagctggaatgcccagaccccagcatccttgcccactacatgaggagg
tttgctaagaccatcgggaaggtgctgatgcagtatgcagacatcttgtcaaaggacttc
ccagcctattgcacaaaggagaaactgccctgcatcctgatgaacaacgtgcagcaactg
agggtccagctggagaaaatgtttgaggccatgggaggcaaggagctggaccttgaagct
gcagacagtctgaaggagctgcaggtgaaactgaatacggttctggatgagctcagcatg
gtgtttggaaacagtttccaggtacggattgatgagtgtgttcgacaaatggccgacatc
ctgggccaggttcggggcacagggaatgcatctccagacgccagggcctcagcggctcag
gatgcagatagcgtactccggcctctcatggacttcctggatggcaacctcaccctcttt
gccactgtgtgtgagaagacggttctgaagcgtgtactgaaggagctctggcgcgtggtg
atgaacacaatggagaggatgattgttctgcccccactcactgaccagacgggcacccag
ctgatcttcactgctgccaaggagctgagccatctttccaaactcaaggatcacatggta
cgagaggaaacacggaatctcactccaaagcagtgtgcagtccttgacctcgccctggac
accatcaagcaatacttccatgcaggaggcaatgggctgaagaaaaccttcctggagaag
agcccagatctgcagtctctacgctatgccctgtctctgtacacacagactactgacact
ctcatcaagacctttgtgcgctcgcagaccacccaagggtctggtgtggacgatcctgtg
ggagaagtctctattcaggtggacttgtttacacaccctggtactggggagcacaaggtc
acagtgaaagtggtggctgccaatgacctcaagtggcagacagcgggtatgttccggcct
ttcgtggaggtgactatggttggcccacaccaaagtgataagaagaggaagttcacaacc
aaatccaaaagcaacaactgggcccccaagtacaatgagacattccacttcctcctggga
aatgaggaggggcccgagtcctatgagttgcagatatgcgtgaaggattactgctttgcc
cgggaagatcgcgtgctagggctggctgtgatgcctctgagggatgtcacagccaagggc
agctgtgcctgctggtgccccttgggccggaagatccatatggatgagacaggcctgacc
attctccggattttatctcagaggagcaatgacgaggtggcccgagaatttgtgaaactc
aaatcagagtctcgttccacggaggaggggagctga

DBGET integrated database retrieval system