KEGG   Homo sapiens (human): 10497
Entry
10497             CDS       T01001                                 

Gene name
UNC13B, MUNC13, UNC13, Unc13h2, munc13-2
Definition
(RefSeq) unc-13 homolog B
  KO
K15293  protein unc-13 A/B/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10497 (UNC13B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10497 (UNC13B)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10497 (UNC13B)
SSDB
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1
Other DBs
NCBI-GeneID: 10497
NCBI-ProteinID: NP_006368
OMIM: 605836
HGNC: 12566
Ensembl: ENSG00000198722
Vega: OTTHUMG00000019856
Pharos: O14795(Tbio)
UniProt: O14795 Q4LE73
Position
9p13.3
AA seq 1591 aa
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgtcactgctctgcgtgcgcgttaaaagggccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtacagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggaacaggatttcatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggactgtgtggatt
gcgctgaagactattcgtcagtcggatgaggaagggcctggggaatggtccacattagag
gcagagacgttaatgaaagacgatgagatctgtggaactagaaacccaactcctcataaa
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaatgggagcaaatcaatgccttgggagctgacaatgagtattctagtcaa
gaagaaagccagaggaagccattgcccactgctgccgcccagtgttcttttgaagaccct
gatagtgccgtcgatgaccgagatagtgactatcgcagtgagaccagcaacagcttccca
cctccttaccatacagcttcccagcccaacgcttctgtgcaccagttccctgtgccggtg
cgatcgccacagcagctgctacttcaaggcagttcccgggactcttgtaatgactctatg
caaagttatgaccttgattatccagagcggcgggctatcagccccaccagcagcagtagg
tatggctcctcctgtaatgtgagtcaaggaagctctcagctaagtgaactagaccagtat
cacgaacaagatgacgaccatcgggagacggactcgattcattcttgccacagctctcac
agcctgtccagagatggccaagcaggttttggagaacaagagaaacccttggaggtgaca
ggtcaagcagagaaggaggcagcatgtgaacccaaggagatgaaagaagatgccacaacc
caccctcccccagatctggtgctgcaaaaagaccacttcctaggtccccaggagagtttt
cctgaggagaatgcatcttcaccatttacccaagccagagcacattggatccgagcagtt
accaaggttcgactccagctgcaggagattccagatgatggtgacccctctctgcctcag
tggctcccggaagggccagccggagggctctatggcattgacagcatgccagatttacgc
agaaagaagccactgccacttgtcagtgatctgtcactggtccagtctcggaaggcagga
atcacttctgcaatggctacacgcacttctcttaaggacgaagagctgaaatcccacgtg
tataagaaaaccctgcaggccttaatctaccccatttcgtgcaccactcctcataacttt
gaggtctggacggccactaccccaacctactgctatgagtgtgaaggcctgctctggggc
attgcccggcagggcatgcgctgcagcgaatgtggagtcaagtgccatgagaagtgccag
gatctgctcaatgctgactgcctgcagcgggctgcagaaaagagctgtaaacatggagct
gaggaccggacccagaacattatcatggccatgaaggaccgcatgaagatccgagagcga
aataagccagagatctttgaagttatccgggacgtcttcacagtgaacaaagctgcccat
gtgcagcagatgaaaacagtgaagcagagtgtactggatggcacctccaaatggtcagcc
aagatcaccattactgtggtgtgtgcccagggcctacaagccaaggacaaaacaggatcc
agtgacccttacgtgactgtgcaagtcagcaaaactaagaagcgtaccaagaccattttt
ggaaacttgaatcctgtttgggaggagaagttccattttgagtgccacaactcctctgac
cgcattaaggtgcgtgtatgggatgaggatgatgacatcaagtcaagagtaaagcaacgc
ctaaagcgagagtctgatgatttccttggccaaaccatcattgaggttcggaccctaagt
ggcgagatggacgtctggtacaacttggagaagaggacagacaaatcagccgtctcaggg
gctatccgactacaaatcagtgtggagatcaagggggaggagaaagtagccccataccac
gtgcagtatacatgtctccatgagaatcttttccattacctcacagacattcagggcagt
ggaggagtccgcatccctgaagctcgaggagacgatgcctggaaggtgtactttgatgag
acagcccaagaaattgtggatgaatttgccatgcgttatggcattgagtccatatatcag
gccatgacgcactttgcatgtttatcatccaagtacatgtgtcctggtgtgccagcagtg
atgagcaccttactggccaacatcaacgcctactatgcccacacaactgcctctaccaat
gtctctgcatctgatcgctttgcagcctccaactttgggaaagagagatttgtaaaactg
ctggaccagctacacaactcactgaggatcgacctctctacatacaggaataatttccct
gctgggagtcctgaacggcttcaggacttaaaatccacagtggatttgctgaccagcatt
actttcttcagaatgaaggtacaagaactgcaaagccctccaagagccagccaggtggta
aaggattgtgtgaaggcctgtttgaactccacatatgaatatatcttcaacaactgccac
gacttatacagccgccagtaccagctgaagcaggagctacctccagaggaacaagggccc
agcattcggaacctggatttctggcccaagctcatcacactcatcgtgtcaatcatagag
gaagataagaattcctacacacctgttctgaaccagtttcctcaggagttgaatgtggga
aaagtcagcgcagaagtgatgtggcatttgtttgcccaagacatgaaatatgcattggag
gagcatgagaaagaccacctgtgtaaaagtgctgactacatgaacctgcacttcaaggtg
aagtggctccacaatgaatacgtgcgggatctgcctgtcctccaggggcaggtgcctgag
tacccagcgtggtttgagcagttcgtgctacaatggctggatgagaatgaggatgtatcc
ctggaattcctgcgtggggccctggaacgagataagaaggatggattccagcagacatca
gagcatgcactcttttcctgctctgtggtggatgtcttcacacaactcaatcagagcttt
gagatcatccggaagctggaatgcccagaccccagcatccttgcccactacatgaggagg
tttgctaagaccatcgggaaggtgctgatgcagtatgcagacatcttgtcaaaggacttc
ccagcctattgcacaaaggagaaactgccctgcatcctgatgaacaacgtgcagcaactg
agggtccagctggagaaaatgtttgaggccatgggaggcaaggagctggaccttgaagct
gcagacagtctgaaggagctgcaggtgaaactgaatacggttctggatgagctcagcatg
gtgtttggaaacagtttccaggtacggattgatgagtgtgttcgacaaatggccgacatc
ctgggccaggttcggggcacagggaatgcatctccagacgccagggcctcagcggctcag
gatgcagatagcgtactccggcctctcatggacttcctggatggcaacctcaccctcttt
gccactgtgtgtgagaagacggttctgaagcgtgtactgaaggagctctggcgcgtggtg
atgaacacaatggagaggatgattgttctgcccccactcactgaccagacgggcacccag
ctgatcttcactgctgccaaggagctgagccatctttccaaactcaaggatcacatggta
cgagaggaaacacggaatctcactccaaagcagtgtgcagtccttgacctcgccctggac
accatcaagcaatacttccatgcaggaggcaatgggctgaagaaaaccttcctggagaag
agcccagatctgcagtctctacgctatgccctgtctctgtacacacagactactgacact
ctcatcaagacctttgtgcgctcgcagaccacccaagggtctggtgtggacgatcctgtg
ggagaagtctctattcaggtggacttgtttacacaccctggtactggggagcacaaggtc
acagtgaaagtggtggctgccaatgacctcaagtggcagacagcgggtatgttccggcct
ttcgtggaggtgactatggttggcccacaccaaagtgataagaagaggaagttcacaacc
aaatccaaaagcaacaactgggcccccaagtacaatgagacattccacttcctcctggga
aatgaggaggggcccgagtcctatgagttgcagatatgcgtgaaggattactgctttgcc
cgggaagatcgcgtgctagggctggctgtgatgcctctgagggatgtcacagccaagggc
agctgtgcctgctggtgccccttgggccggaagatccatatggatgagacaggcctgacc
attctccggattttatctcagaggagcaatgacgaggtggcccgagaatttgtgaaactc
aaatcagagtctcgttccacggaggaggggagctga

KEGG   Homo sapiens (human): 23025
Entry
23025             CDS       T01001                                 

Gene name
UNC13A, Munc13-1
Definition
(RefSeq) unc-13 homolog A
  KO
K15293  protein unc-13 A/B/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    23025 (UNC13A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23025 (UNC13A)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    23025 (UNC13A)
SSDB
Motif
Pfam: C2 Membr_traf_MHD DUF1041 C1_1 APG6_N
Other DBs
NCBI-GeneID: 23025
NCBI-ProteinID: NP_001073890
OMIM: 609894
HGNC: 23150
Ensembl: ENSG00000130477
Vega: OTTHUMG00000163877
Pharos: Q9UPW8(Tbio)
UniProt: Q9UPW8
Position
19p13.11
AA seq 1703 aa
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQHNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPQALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSDMEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEELPEDEEELEEEEEEVPDDLGSYAQ
REDVAVAEPKDFKRISLPPAAPGKEDKAPVAPTEAPDMAKVAPKPATPDKVPAAEQIPEA
EPPKDEESFRPREDEEGQEGQDSMSRAKANWLRAFNKVRMQLQEARGEGEMSKSLWFKGG
PGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKKT
LQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKTAHTQQM
KAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLN
PVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMD
VWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNGVVK
IPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTL
LANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSP
ERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYS
REYQTDPAKKGEVLPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVG
KISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPAFKDRVPE
YPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSF
EIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVPCILMNNTQ
QLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVKQMG
DILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWK
LVMNTMEKTIVLPPLTDQTMIGNLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKELGQLS
KLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSL
YTQATDLLIKTFVQTQSAQGLGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQ
TSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFTLSADAGPECYELQVC
VKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEV
AKEFVKLKSDTRSAEEGGAAPAP
NT seq 5112 nt   +upstreamnt  +downstreamnt
atgtctctgctttgcgttggagtcaaaaaagccaagtttgatggtgcccaagagaaattc
aacacgtacgtgaccctgaaagtgcagaatgtcaagagcacgaccatcgcggtgcggggc
agccagcccagctgggagcaggatttcatgttcgagattaaccgtctggatttgggactg
acggtggaggtgtggaataagggtctcatctgggacacaatggtgggcactgtgtggatc
ccactgaggaccatccgccagtccaatgaggagggccctggagagtggctgacgctggac
tcccaggtcatcatggcagacagtgagatctgtggcaccaaggaccccaccttccaccgc
atcctcctggacacgcgctttgagctacccttagacattcctgaagaggaggctcgctac
tgggccaagaagctggagcagctcaatgctatgcgggaccaggatgaatattcgttccaa
gatgagcaagacaagcctctgcctgtccccagcaaccagtgctgcaactggaattatttt
ggctggggtgagcagcacaacgatgaccccgacagtgcagtggatgatcgtgacagtgac
taccgcagtgaaacgagcaacagcatcccgccgccctattatactacgtcacaacccaac
gcctcagtccaccaatattctgttcgcccaccacccctgggctcccgggagtcctacagt
gactccatgcacagttacgaggagttctctgagccacaagccctcagccccacgggtagc
agccgctatgcctcttccggggagctgagccagggaagctctcagctgagcgaggacttc
gaccctgacgagcacagcctgcagggctccgacatggaggatgagcgggaccgggactcc
taccactcctgccacagctcggtcagctaccacaaagactcgcctcgctgggaccaggat
gaggaagagctggaggaggacctggaggacttcctggaggaggaggagctgcctgaagat
gaggaggagctggaggaggaggaggaggaggtgcctgacgatttgggcagctatgcccag
cgtgaagacgtagctgtggctgagcccaaagacttcaaacgcatcagcctcccgccagct
gccccagggaaggaggacaaggccccagtggcacccaccgaggcccccgacatggccaag
gtggcccccaagccagccacgcccgacaaggtgcctgcagctgagcagatccctgaggct
gagccacccaaggacgaggagagtttcaggccgagagaggatgaggaaggccaggagggg
caggactccatgtccagggccaaggccaactggctgcgtgccttcaacaaggtgcggatg
cagctgcaggaggcccggggagaaggagagatgtctaaatccctatggttcaaaggcggc
ccagggggcggtctcatcatcatcgacagcatgccagacatccgcaagaggaaacctatc
ccactcgtgagcgacttggccatgtccctggtccagtccaggaaagcgggcatcacctcg
gccttggcctccagcacgttgaacaacgaggagctgaaaaaccacgtttacaagaagacc
ctgcaagccttaatctaccccatctcgtgcacgacgccacacaacttcgaagtgtggacg
gccaccacgcccacctactgctacgagtgcgaggggctgctgtggggcatcgcgaggcag
ggcatgcgctgcaccgagtgcggtgtcaagtgccacgagaagtgccaggacctgctcaac
gccgactgcctgcagcgggctgcggagaagagctccaagcacggggcggaggaccggaca
cagaacatcatcatggtgctcaaggaccgcatgaagatccgggagcgcaacaagcccgag
atcttcgagctcatccaggagatcttcgcggtgaccaagacggcgcacacgcagcagatg
aaggcggtcaagcagagcgtgctggacggcacgtccaagtggtccgccaagatcagcatc
accgtggtctgcgcccagggcttgcaggcaaaggacaagacaggatccagtgacccctat
gtcaccgtccaggtcgggaagaccaagaaacggacaaaaaccatctatgggaacctcaac
ccggtgtgggaggagaatttccactttgaatgtcacaattcctccgaccgcatcaaggtg
cgcgtctgggacgaggatgacgacatcaaatcccgcgtgaaacagaggttcaagagggaa
tctgacgatttcctggggcagacgatcattgaggtgcggacgctcagcggcgagatggac
gtgtggtacaacctggacaagcgaactgacaaatctgccgtgtcgggtgccatccggctc
cacatcagtgtggagatcaaaggcgaggagaaggtggccccgtaccatgtccagtacacc
tgtctgcatgagaacctgttccacttcgtgaccgacgtgcagaacaatggggtcgtgaag
atcccagatgccaagggtgacgatgcctggaaggtttactacgatgagacagcccaggag
attgtggacgagtttgccatgcgctacggcgtcgagtccatctaccaagccatgacccac
tttgcctgcctctcctccaagtatatgtgcccaggggtgcctgccgtcatgagcaccctg
ctcgccaacatcaatgcctactacgcacacaccaccgcctccaccaacgtgtctgcctcc
gaccgcttcgccgcctccaactttgggaaagagcgcttcgtgaaactcctggaccagctg
cataactccctgcggattgacctctccatgtaccggaataacttcccagccagcagcccg
gagagactccaggacctcaaatccactgtggaccttctcaccagcatcaccttctttcgg
atgaaggtacaagaactccagagcccgccccgagccagccaggtggtaaaggactgtgtg
aaagcctgccttaattctacctacgagtacatcttcaataactgccatgaactgtacagc
cgggagtaccagacagacccggccaagaagggggaagttctcccagaggaacaggggccc
agcatcaagaacctcgacttctggtccaagctgattaccctcatagtgtccatcattgag
gaagacaagaattcctacactccctgcctcaaccagtttccccaggagctgaatgtgggt
aaaatcagcgctgaagtgatgtggaatctgtttgcccaagacatgaagtacgccatggag
gagcacgacaagcatcgtctatgcaagagtgccgactacatgaacctccacttcaaggtg
aaatggctctacaatgagtatgtgacggaacttcccgccttcaaggaccgcgtgcctgag
taccctgcatggtttgaacccttcgtcatccagtggctggatgagaatgaggaggtgtcc
cgggatttcctgcacggtgccctggagcgagacaagaaggatgggttccagcagacctca
gagcatgccctattctcctgctccgtggtggatgttttctcccaactcaaccagagcttt
gaaatcatcaagaaactcgagtgtcccgaccctcagatcgtggggcactacatgaggcgc
tttgccaagaccatcagtaatgtgctcctccagtatgcagacatcatctccaaggacttt
gcctcctactgctccaaggagaaggagaaagtgccctgcattctcatgaataacactcaa
cagctacgagttcagctggagaagatgttcgaagccatgggaggaaaggagctggatgct
gaagccagtgacatcctgaaggagcttcaggtgaaactcaataacgtcttggatgagctc
agccgggtgtttgctaccagcttccagccgcacattgaagagtgtgtcaaacagatgggt
gacatccttagccaggttaagggcacaggcaatgtgccagccagtgcctgcagcagcgtg
gcccaggacgcggacaatgtgttgcagcccatcatggacctgctggacagcaacctgacc
ctctttgccaaaatctgtgagaagactgtgctgaagcgagtgctgaaggagctgtggaag
ctggttatgaacaccatggagaaaaccatcgtcctgccgcccctcactgaccagacgatg
atcgggaacctcttgagaaaacatggcaagggattagaaaagggcagggtgaaattgcca
agccactcagacggaacccagatgatcttcaatgcagccaaggagctgggtcagctgtcc
aaactcaaggatcacatggtacgagaagaagccaagagcttgaccccaaagcagtgcgcg
gttgttgagttggccctggacaccatcaagcaatatttccacgcgggtggcgtgggcctc
aagaagaccttcctggagaagagcccggacctgcaatccttgcgctatgccctgtcgctc
tacacgcaggccaccgacctgctaatcaagacctttgtacagacgcaatcggcccagggc
ttgggtgtagaagaccctgtgggtgaagtctctgtccatgttgagctgttcactcatcca
ggaactggggaacacaaggtcacagtgaaagtggtggctgccaatgacctcaagtggcag
acttctggcatcttccggccgttcatcgaggtcaacatcattgggccccagctcagcgac
aagaaacgcaagtttgcgaccaaatccaagaacaatagctgggctcccaagtacaatgag
agcttccagttcacgctgagcgccgacgcgggtcccgagtgctatgagctgcaggtgtgc
gtcaaggactactgcttcgcgcgcgaggaccgcacggtggggctggccgtgctgcagctg
cgtgagctggcccagcgcgggagcgccgcctgctggctgccgctcggccgccgcatccac
atggacgacacgggcctcacggtgctgcgaatcctctcgcagcgcagcaacgacgaggtg
gccaaggagttcgtgaagctcaagtcggacacgcgctccgccgaggagggcggtgccgcg
cctgcgccttag

KEGG   Homo sapiens (human): 440279
Entry
440279            CDS       T01001                                 

Gene name
UNC13C
Definition
(RefSeq) unc-13 homolog C
  KO
K15293  protein unc-13 A/B/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    440279 (UNC13C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    440279 (UNC13C)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    440279 (UNC13C)
SSDB
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1 DUF2205 TolA_bind_tri
Other DBs
NCBI-GeneID: 440279
NCBI-ProteinID: NP_001074003
OMIM: 614568
HGNC: 23149
Ensembl: ENSG00000137766
Vega: OTTHUMG00000172542
Pharos: Q8NB66(Tdark)
UniProt: Q8NB66
Position
15q21.3
AA seq 2214 aa
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYRQQKKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVTEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMAIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PKDQHLNGGVQGIQGQTETENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQGADLGLDSSTQEGFDYETNSLFDQQLDVYNKDLEYLGKCHSDLQDDSESYDLTQDDNS
SPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKSWH
SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
ANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITETDE
QMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPEQPV
EITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQ
VCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHV
FKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQ
DLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKEDF
VQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIF
GNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLS
GEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSN
GGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAV
MSTLLANINAFYAHTTVSTNIQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYREN
FPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDN
CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE
LNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKD
AVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFAQL
NQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCILMNN
IQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECIKQ
MSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLKELW
KLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAIMEV
VLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRSSK
DAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRK
QGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIA
EKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA
NT seq 6645 nt   +upstreamnt  +downstreamnt
atggtggctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaacaaagagtatcgtcagcagaaaaag
gatcaagacttccccactgctggccagaccaaatcccccaaattttcttacacttttaaa
agcactgtaaagaagattgcaaagtgttcatccactcacaacttatccactgaggaagac
gaggccagtaaagagttttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatgctaaagtaaccaacagtgataatgaggatctgcttcaagagctc
tcttcaatcgagagttcctactcagaatcattaaatgaactaaggagtagcacagaaaac
caggcacaatcaacacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgacggggagcgtactctacatggcttaaaactgggagct
ttacgaaaactgagaaaatggaaaaagagtcaagaatgtgtctcctcagactcagagtta
agcaccatgaaaaaatcctggggaataagaagtaagtctttggacagaactgtccgaaac
ccaaagacaaatgccctggagccagggttcagttcctctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcacgtcaatgctctcaagcactccatcgatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagttgcgcacagggtttgtccagtctcggagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaatgtgactgaagaaagatttgaatatgttgaaagcgtggtgtaccaa
attctaatagataaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagagactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcaacaaagggattctgtcttaaaaaagtcatataaactcaaaggaaca
ggcattggaatctcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatatgagagcatggctataaagttgtctactccagagccaaaa
atcaagaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctc
aatagaaacagttacgctgtgctttccaagtcagagcttctaacaaagggaagtacttcc
aagccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcaga
atttcaaataaatcagattatgataaaatctcctcacagttgccagaatcagatatcttg
gaaaagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttac
tcagaagatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtca
tcttcggaccgggagctatggcagaggaaacaggaaggaacagcgaccctgtatgacagt
cccaaggaccagcatttgaatggaggtgttcagggtatccaagggcagactgaaactgaa
aacacagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccgg
agtcattacagtgattctcagctctctttacatgaggatctttctccatggaaggaatgg
aatcaaggagctgatttaggcttggattcatccacccaggaaggttttgattatgaaaca
aacagtctttttgaccaacagcttgatgtttacaataaagacctagaatacttgggaaag
tgccacagtgatcttcaagatgactcagagagctacgacttaactcaagatgacaattct
tctccatgccctggcttggataatgaaccacaaggccagtgggttggccaatatgattct
tatcagggagctaattctaatgagctataccaaaatcaaaaccagttgtccatgatgtat
cgaagtcaaagtgaattgcaaagtgatgattcagaggatgccccacccaaatcatggcat
agtcgattaagcattgacctttctgataagactttcagcttcccaaaatttggatctaca
ctgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacagagtctgagt
gggtatgaggacagtggctcttcattaatggggagatttcggacattatctcaatcaact
gcaaatgagtcaagtaccacacttgactctgatgtctacacggagccctattactataaa
gcagaggatgaggaagattatactgaaccagtggctgacaatgaaacagattatgttgaa
gtcatggaacaagtccttgctaaactagaaaacaggactagtattactgaaacagatgaa
caaatgcaagcatatgatcacctttcatatgaaacaccttatgaaaccccacaagatgag
ggttatgatggtccagcagatgatatggttagtgaagaggggttagaacccttaaatgaa
acatcagctgagatggaaataagagaagatgaaaaccaaaacattcctgaacagccagtg
gagatcacaaagccaaagagaattcgtccttctttcaaagaagcagctttaagggcctat
aaaaagcaaatggcagagttggaagagaagatcttggctggagatagcagttctgtggat
gaaaaggctcgaatagtaagtggcaatgatttggatgcttccaaattttctgcactccag
gtgtgtggtggggctggaggtggactttatggtattgacagcatgccggatcttcgcaga
aaaaaaactttgcctattgtccgagatgtggccatgaccctggctgcccggaaatctgga
ctctccctggctatggtgattaggacatccctaaataatgaggaactgaaaatgcacgtc
ttcaagaagaccttgcaggcactgatctaccctatgtcttctaccatcccacacaatttt
gaggtctggacggctaccacacccacctactgttatgagtgtgaagggctcctgtggggc
attgcaaggcaaggcatgaagtgtctggagtgtggagtgaaatgccacgaaaagtgtcag
gacctgctaaacgctgactgcttgcagagagcagcagaaaagagttctaaacatggtgcc
gaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatcagggagaaa
aaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaagaagatttt
gtgcagtttacaaaggcggccaaacagagtgtactggatgggacatctaagtggtctgca
aaaataaccattacagtggtttctgcacagggtctacaggcaaaagataaaacagggtct
agtgatccatatgttacagttcaagttggaaagaacaaaagaagaacaaaaaccattttt
ggaaatttgaatccagtatgggatgagaagttttattttgagtgtcataactccacagat
cgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtcaagcaacat
ttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggaccttgagt
ggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagctgtatctggg
gccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgctccatatcat
attcaatatacatgtttacatgagaatctgttccattacttgactgaagtgaaatctaat
ggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttctttgatgat
gcttcccaagaaatagttgatgaatttgctatgcgttatggaattgaatccatttatcaa
gctatgacgcacttttcatgtctgtcttctaaatacatgtgccccggtgtccctgccgtc
atgagcaccttgctggctaatataaatgctttttatgctcacacaacagtttcaacaaac
atacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaaaaattcata
aaactactggaccagttacataactctttgaggattgatctgtcaaagtatagggaaaac
tttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgacctgttaaca
agtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaagcgagcatg
gtggtgaaggactgtgtaagggcttgcctggattctacatacaagtatatttttgacaac
tgccatgaactctactcccagctaacagacccgagtaagaaacaggatattcctcgtgaa
gatcagggaccaaccaccaagaatttggatttttggccccaacttattacactgatggtt
actattattgatgaggataaaactgcctacacacctgtcctgaatcagtttcctcaagag
ctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctggatatgaaa
tatgcattagaagaacatgaaaatcagcggttatgcaagagcaccgattatatgaatttg
catttcaaagttaaatggttttataatgaatatgtgcgtgaacttcctgccttcaaggat
gctgttcctgaatactccttgtggtttgaaccttttgtcatgcaatggctagatgaaaac
gaagatgtgtcaatggaattccttcatggagcactgggaagagacaaaaaagatggattc
cagcagacatctgagcatgctctcttttcttgctccgtggttgatgtctttgctcagctg
aatcagagctttgaaattattaagaaactggaatgccctaatcctgaagcattatctcac
ttaatgagaagatttgcaaagactatcaataaagtgctgctccagtatgctgcaattgta
tcaagtgatttcagttcacattgtgataaggaaaatgtgccctgtatcttgatgaacaat
attcaacaattgcgggtccagctggaaaaaatgtttgaatccatgggagggaaggagcta
gattctgaagctagtactattctaaaagaacttcaggttaagctcagtggggtcctggat
gagctcagcgtcacttatggtgaaagtttccaggttataattgaagagtgtataaaacag
atgagtttcgaactaaatcaaatgagagcaaatggaaacaccacatctaataagaacagt
gcagcaatggatgcagagattgtgttaagatctcttatggattttttggacaaaacatta
agtctctcagcaaaaatctgtgagaaaacagtcctaaagcgagttttaaaagagttatgg
aagctagttctcaacaaaatagaaaaacaaattgttcttcctcctctgacagatcaaaca
ggaccccagatgattttcattgcagctaaagatcttggacaattatccaaactgaaggag
cacatgattcgagaggatgccaggggtctgacgccaagacaatgcgctataatggaggta
gtcctggctaccatcaagcaatactttcatgcaggaggaaatggcctgaaaaagaatttc
ttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacccaaact
actgatgccttgataaagaaattcatagatactcaaacctcacagagtcgttcctccaaa
gatgccgtgggtcagatatctgttcatgtggacatcactgccaccccaggaacgggagat
cataaagtcactgtaaaagtgattgctattaatgacctaaactggcagaccacagcaatg
ttccgcccctttgtggaagtttgtatactgggacccaaccttggagacaagaagagaaaa
caaggcacaaaaacaaaaagcaacacatggtcaccaaagtacaatgaaacatttcagttc
attctcggaaaggaaaatcgaccaggggcttatgaacttcatctctcagttaaggattac
tgctttgccagagaagatcgaattatcggaatgacagtcattcagctacagaacatagca
gaaaagggaagctatggggcatggtatcctcttctgaaaaatatctctatggatgaaact
ggtttgactatccttagaatactctctcagaggaccagtgatgatgtggctaaagaattt
gtaagacttaaatctgaaacaagatctactgaagagagtgcttga

DBGET integrated database retrieval system