KEGG   Homo sapiens (human): 10498
Entry
10498             CDS       T01001                                 

Symbol
CARM1, PRMT4
Name
(RefSeq) coactivator associated arginine methyltransferase 1
  KO
K05931  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    10498 (CARM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10498 (CARM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     10498 (CARM1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     10498 (CARM1)
SSDB
Motif
Pfam: CARM1 PrmA Methyltransf_25 MTS Methyltransf_9 Methyltransf_11 PRMT5 Methyltransf_31 Methyltransf_23 Methyltransf_18 Methyltransf_12 CMAS TehB Met_10 Cons_hypoth95 Methyltransf_32 PRMT5_C DREV
Other DBs
NCBI-GeneID: 10498
NCBI-ProteinID: NP_954592
OMIM: 603934
HGNC: 23393
Ensembl: ENSG00000142453
Vega: OTTHUMG00000180699
Pharos: Q86X55(Tchem)
UniProt: Q86X55
Structure
PDB: 

Position
19p13.2
AA seq 608 aa
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcagcggcggcggcggcggtggggccgggcgcgggcggcgcggggtcggcggtcccg
ggcggcgcggggccctgcgctaccgtgtcggtgttccccggcgcccgcctcctcaccatc
ggcgacgcgaacggcgagatccagcggcacgcggagcagcaggcgctgcgcctcgaggtg
cgcgccggcccggactcggcgggcatcgccctctacagccatgaagatgtgtgtgtcttt
aagtgctcagtgtcccgagagacagagtgcagccgtgtgggcaagcagtccttcatcatc
accctgggctgcaacagcgtcctcatccagttcgccacacccaacgatttctgttccttc
tacaacatcctgaaaacctgccggggccacaccctggagcggtctgtgttcagcgagcgg
acggaggagtcttctgccgtgcagtacttccagttttatggctacctgtcccagcagcag
aacatgatgcaggactacgtgcggacaggcacctaccagcgcgccatcctgcaaaaccac
accgacttcaaggacaagatcgttcttgatgttggctgtggctctgggatcctgtcgttt
tttgccgcccaagctggagcacggaaaatctacgcggtggaggccagcaccatggcccag
cacgctgaggtcttggtgaagagtaacaacctgacggaccgcatcgtggtcatcccgggc
aaggtggaggaggtgtcactccccgagcaggtggacatcatcatctcggagcccatgggc
tacatgctcttcaacgagcgcatgctggagagctacctccacgccaagaagtacctgaag
cccagcggaaacatgtttcctaccattggtgacgtccaccttgcacccttcacggatgaa
cagctctacatggagcagttcaccaaggccaacttctggtaccagccatctttccatgga
gtggacctgtcggccctccgaggtgccgcggtggatgagtatttccggcagcctgtggtg
gacacatttgacatccggatcctgatggccaagtctgtcaagtacacggtgaacttctta
gaagccaaagaaggagatttgcacaggatagaaatcccattcaaattccacatgctgcat
tcagggctggtccacggcctggctttctggtttgacgttgctttcatcggctccataatg
accgtgtggctgtccacagccccgacagagcccctgacccactggtaccaggtgcggtgc
ctgttccagtcaccactgttcgccaaggcaggggacacgctctcagggacatgtctgctt
attgccaacaaaagacagagctacgacatcagtattgtggcccaggtggaccagaccggc
tccaagtccagtaacctcctggatctgaaaaaccccttctttagatacacgggcacaacg
ccctcacccccacccggctcccactacacatctccctcggaaaacatgtggaacacgggc
agcacctacaacctcagcagcgggatggccgtggcagggatgccgaccgcctatgacttg
agcagtgttattgccagtggctccagcgtgggccacaacaacctgattcctttagccaac
acggggattgtcaatcacacccactcccggatgggctccataatgagcacggggattgtc
caagggtcctccggcgcccagggcagtggtggtggcagcacgagtgcccactatgcagtc
aacagccagttcaccatgggcggccccgccatctccatggcgtcgcccatgtccatcccg
accaacaccatgcactacgggagctag

DBGET integrated database retrieval system