KEGG   Homo sapiens (human): 10500
Entry
10500             CDS       T01001                                 

Symbol
SEMA6C, SEMAY, m-SemaY, m-SemaY2
Name
(RefSeq) semaphorin 6C
  KO
K06842  semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    10500 (SEMA6C)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 10500
NCBI-ProteinID: NP_112175
OMIM: 609294
HGNC: 10740
Ensembl: ENSG00000143434
Vega: OTTHUMG00000012261
Pharos: Q9H3T2(Tdark)
UniProt: Q9H3T2
Position
1q21.3
AA seq 930 aa
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGLEDDAVAAELG
LDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKYLTWRSQDVENCAVRGKLTDE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAI
FAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVQALEHGDHVYFFF
REVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHPLLDPAVPPVTHQPLLTLTSR
ALLTQVAVDGMAGPHSNITVMFLGSNDGTVLKVLTPGGRSGGPEPILLEEIDAYSPARCS
GKRTAQTARRIIGLELDTEGHRLFVAFSGCIVYLPLSRCARHGACQRSCLASQDPYCGWH
SSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYGVRRDLPPASASRS
VPIPLLLASVAAAFALGASVSGLLVSCACRRAHRRRGKDIETPGLPRPLSLRSLARLHGG
GPEPPPPSKDGDAVQTPQLYTTFLPPPEGVPPPELACLPTPESTPELPVKHLRAAGDPWE
WNQNRNNAKEGPGRSRGGHAAGGPAPRVLVRPPPPGCPGQAVEVTTLEELLRYLHGPQPP
RKGAEPPAPLTSRALPPEPAPALLGGPSPRPHECASPLRLDVPPEGRCASAPARPALSAP
APRLGVGGGRRLPFSGHRAPPALLTRVPSGGPSRYSGGPGKHLLYLGRPEGYRGRALKRV
DVEKPQLSLKPPLVGPSSRQAVPNGGRFNF
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgccccgtgccccccacttcatgcccttgctgctactgctgctgctgctctcacttccc
catactcaggccgcctttccccaggaccccctccctctgttgatctctgaccttcaaggt
acttccccattatcctggtttcggggcctggaggatgatgctgtggctgcagaacttggg
ctggactttcagagattcctgaccttgaaccggaccttgctagtggctgcccgggatcac
gttttctccttcgatcttcaagccgaagaagaaggggaggggctggtgcccaacaagtat
ctaacatggagaagccaagatgtggagaactgtgctgtacggggaaagctgacggatgag
tgctacaactatattcgtgttcttgttccctgggactcccagacgctccttgcctgtgga
acgaactcattcagccctgtgtgccgcagctatgggataacttcgctgcagcaggagggt
gaggaactgagtgggcaggctcgatgcccctttgatgccacccagtccaacgtggccatc
tttgcagagggcagcctgtactcagccacagctgcggatttccaggccagtgatgctgta
gtttacagaagccttgggccccagcccccactccgctccgccaagtatgactccaagtgg
ctccgagagccacactttgtccaggccttggagcatggagaccatgtctacttcttcttc
cgcgaggtctctgtggaggatgctcggctggggagggtgcagttctcccgcgtagcccga
gtatgtaaacgtgacatgggcggctcgcctcgggccttggaccgccactggacatccttc
ctgaagcttcggctcaactgctctgtccctggggactctactttctattttgatgtttta
caggccttgactgggcctgtgaacctgcatggccgctctgctctctttggggtcttcacc
acccagaccaatagcatccctggctctgccgtctgcgccttctacctggatgagattgag
cgtgggtttgagggcaagttcaaggagcagaggagtctggatggggcctggactcctgtg
tctgaggacagagttccctcacccaggccaggatcctgtgcaggagtagggggagctgcc
ttgttctcctcttcccgagacctccctgatgatgtcctgaccttcatcaaggctcacccg
ctgctggaccccgctgtaccacctgtcacccatcagcctctactcactctcactagcagg
gccctactgacccaagtagctgtggatggcatggctggtccccacagtaacatcacagtc
atgttccttggctccaatgatgggacagtgctgaaggtgctgaccccaggtgggcgatcc
gggggacctgagcccatcctcctggaagagattgatgcctacagccctgcccggtgcagt
gggaagcggacagcccaaacagcacgacggatcatagggctggagctggacactgagggt
cacaggctttttgtggctttttctggctgtattgtctacctccctctcagccggtgtgcc
cggcatggggcctgtcagaggagctgtttggcttctcaggacccatactgtggatggcat
agctccaggggctgtgtggatatcaggggatctggtgggactgatgtggatcaggctggg
aaccaggaatccatggagcatggtgactgccaagatggagctactgggagtcagtctggc
cctggggattctgcttatggcgtgcgccgggacctgcccccagcctcggcctcccgctcc
gtccccatcccactcctcctggccagtgtggccgcagcttttgccctgggcgcctcagtc
tctggcctcctggtctcctgtgcttgtcgccgcgcccaccgacgtcggggcaaggacatc
gagactccggggctcccgcgccctctctccctccgcagtttggcccggctccacggtggg
ggcccagagcccccgccgccctccaaggacggggacgcggtgcagacgccgcagctctac
accaccttcctgccgcctccggagggcgtgcccccgccggagctggcctgcctgcccacc
cccgagtccacgccggagctgccggtcaagcacctccgcgccgccggggacccctgggag
tggaaccagaacaggaacaacgccaaggagggtccgggccgctcacggggcgggcacgcg
gcgggcgggcccgcgccccgcgtgctggtgaggccaccgccgcccggctgtcccgggcag
gccgtggaagtcaccaccctggaggaactgctgcgctacctgcacggcccgcagccgccc
agaaagggggccgagccccccgcccctttaacctcgcgggcgctcccgccggagcccgcc
cccgccctcttgggcggccccagccccaggccccacgagtgcgcctcgccgctgaggctg
gacgtgccccccgagggcaggtgcgcctctgcccccgcccggcccgcgctctccgccccc
gctccccggctgggcgtcggcggaggccggaggttgcctttctccggccaccgggccccc
cctgccctgctcactcgagtcccctcgggaggtccctccaggtactccgggggtcccggg
aagcacctcctgtacctgggccggcccgagggctaccggggccgcgccctgaaaagggtg
gacgtcgagaagccccagttgtccctgaagcctcccctcgtcgggccctcctcccgccag
gccgtcccgaacggcggccgtttcaacttttaa

KEGG   Homo sapiens (human): 10501
Entry
10501             CDS       T01001                                 

Symbol
SEMA6B, EPM11, SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Name
(RefSeq) semaphorin 6B
  KO
K06842  semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    10501 (SEMA6B)
SSDB
Motif
Pfam: Sema PSI LapA_dom Squash
Other DBs
NCBI-GeneID: 10501
NCBI-ProteinID: NP_115484
OMIM: 608873
HGNC: 10739
Ensembl: ENSG00000167680
Vega: OTTHUMG00000182011
Pharos: Q9H3T3(Tdark)
UniProt: Q9H3T3
Position
19p13.3
AA seq 888 aa
MQTPRASPPRPALLLLLLLLGGAHGLFPEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAE
GADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKG
KQEGECRNFVKVLLLRDESTLFVCGSNAFNPVCANYSIDTLQPVGDNISGMARCPYDPKH
ANVALFSDGMLFTATVTDFLAIDAVIYRSLGDRPTLRTVKHDSKWFKEPYFVHAVEWGSH
VYFFFREIAMEFNYLEKVVVSRVARVCKNDVGGSPRVLEKQWTSFLKARLNCSVPGDSHF
YFNVLQAVTGVVSLGGRPVVLAVFSTPSNSIPGSAVCAFDLTQVAAVFEGRFREQKSPES
IWTPVPEDQVPRPRPGCCAAPGMQYNASSALPDDILNFVKTHPLMDEAVPSLGHAPWILR
TLMRHQLTRVAVDVGAGPWGNQTVVFLGSEAGTVLKFLVRPNASTSGTSGLSVFLEEFET
YRPDRCGRPGGGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIGSQ
DPYCGWAPDGSCIFLSPGTRAAFEQDVSGASTSGLGDCTGLLRASLSEDRAGLVSVNLLV
TSSVAAFVVGAVVSGFSVGWFVGLRERRELARRKDKEAILAHGAGEAVLSVSRLGERRAQ
GPGGRGGGGGGGAGVPPEALLAPLMQNGWAKATLLQGGPHDLDSGLLPTPEQTPLPQKRL
PTPHPHPHALGPRAWDHGHPLLPASASSSLLLLAPARAPEQPPAPGEPTPDGRLYAARPG
RASHGDFPLTPHASPDRRRVVSAPTGPLDPASAADGLPRPWSPPPTGSLRRPLGPHAPPA
ATLRRTHTFNSGEARPGDRHRGCHARPGTDLAHLLPYGGADRTAPPVP
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgcagaccccgcgagcgtcccctccccgcccggccctgctgcttctgctgctgctactg
gggggcgcccacggcctctttcctgaggagccgccgccgcttagcgtggcccccagggac
tacctgaaccactatcccgtgtttgtgggcagcgggcccggacgcctgacccccgcagaa
ggtgctgacgacctcaacatccagcgagtcctgcgggtcaacaggacgctgttcattggg
gacagggacaacctctaccgcgtagagctggagccccccacgtccacggagctgcggtac
cagaggaagctgacctggagatctaaccccagcgacataaacgtgtgtcggatgaagggc
aaacaggagggcgagtgtcgaaacttcgtaaaggtgctgctccttcgggacgagtccacg
ctctttgtgtgcggttccaacgccttcaacccggtgtgcgccaactacagcatagacacc
ctgcagcccgtcggagacaacatcagcggtatggcccgctgcccgtacgaccccaagcac
gccaatgttgccctcttctctgacgggatgctcttcacagctactgttaccgacttccta
gccattgatgctgtcatctaccgcagcctcggggacaggcccaccctgcgcaccgtgaaa
catgactccaagtggttcaaagagccttactttgtccatgcggtggagtggggcagccat
gtctacttcttcttccgggagattgcgatggagtttaactacctggagaaggtggtggtg
tcccgcgtggcccgagtgtgcaagaacgacgtgggaggctccccccgcgtgctggagaag
cagtggacgtccttcctgaaggcgcggctcaactgctctgtacccggagactcccatttc
tacttcaacgtgctgcaggctgtcacgggcgtggtcagcctcgggggccggcccgtggtc
ctggccgttttttccacgcccagcaacagcatccctggctcggctgtctgcgcctttgac
ctgacacaggtggcagctgtgtttgaaggccgcttccgagagcagaagtcccccgagtcc
atctggacgccggtgccggaggatcaggtgcctcgaccccggcccgggtgctgcgcagcc
cccgggatgcagtacaatgcctccagcgccttgccggatgacatcctcaactttgtcaag
acccaccctctgatggacgaggcggtgccctcgctgggccatgcgccctggatcctgcgg
accctgatgaggcaccagctgactcgagtggctgtggacgtgggagccggcccctggggc
aaccagaccgttgtcttcctgggttctgaggcggggacggtcctcaagttcctcgtccgg
cccaatgccagcacctcagggacgtctgggctcagtgtcttcctggaggagtttgagacc
taccggccggacaggtgtggacggcccggcggtggcgagacagggcagcggctgctgagc
ttggagctggacgcagcttcggggggcctgctggctgccttcccccgctgcgtggtccga
gtgcctgtggctcgctgccagcagtactcggggtgtatgaagaactgtatcggcagtcag
gacccctactgcgggtgggcccccgacggctcctgcatcttcctcagcccgggcaccaga
gccgcctttgagcaggacgtgtccggggccagcacctcaggcttaggggactgcacagga
ctcctgcgggccagcctctccgaggaccgcgcggggctggtgtcggtgaacctgctggta
acgtcgtcggtggcggccttcgtggtgggagccgtggtgtccggcttcagcgtgggctgg
ttcgtgggcctccgtgagcggcgggagctggcccggcgcaaggacaaggaggccatcctg
gcgcacggggcgggcgaggcggtgctgagcgtcagccgcctgggcgagcgcagggcgcag
ggtcccgggggccggggcggaggcggtggcggtggcgccggggttcccccggaggccctg
ctggcgcccctgatgcagaacggctgggccaaggccacgctgctgcagggcgggccccac
gacctggactcggggctgctgcccacgcccgagcagacgccgctgccgcagaagcgcctg
cccactccgcacccgcacccccacgccctgggcccccgcgcctgggaccacggccacccc
ctgctcccggcctccgcttcatcctccctcctgctgctggcgcccgcccgggcccccgag
cagccccccgcgcctggggagccgacccccgacggccgcctctatgctgcccggcccggc
cgcgcctcccacggcgacttcccgctcaccccccacgccagcccggaccgccggcgggtg
gtgtccgcgcccacgggccccttggacccagcctcagccgccgatggcctcccgcggccc
tggagcccgcccccgacgggcagcctgaggaggccactgggcccccacgcccctccggcc
gccaccctgcgccgcacccacacgttcaacagcggcgaggcccggcctggggaccgccac
cgcggctgccacgcccggccgggcacagacttggcccacctcctcccctatgggggggcg
gacaggactgcgccccccgtgccctag

KEGG   Homo sapiens (human): 57556
Entry
57556             CDS       T01001                                 

Symbol
SEMA6A, HT018, SEMA, SEMA6A1, SEMAQ, VIA
Name
(RefSeq) semaphorin 6A
  KO
K06842  semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    57556 (SEMA6A)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 57556
NCBI-ProteinID: NP_065847
OMIM: 605885
HGNC: 10738
Ensembl: ENSG00000092421
Vega: OTTHUMG00000162987
Pharos: Q9H2E6(Tbio)
UniProt: Q9H2E6
Position
5q23.1
AA seq 1030 aa
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDALFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYD
GVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWIKEGG
ACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESR
GGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHDQLVPVTLLAIAVILAFV
MGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPE
AILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKPSRGSREWERN
QNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGL
SKRLEMHHSSSYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPP
PAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLS
TSMKPNDACT
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgaggtcagaagccttgctgctatatttcacactgctacactttgctggggctggtttc
ccagaagattctgagccaatcagtatttcgcatggcaactatacaaaacagtatccggtg
tttgtgggccacaagccaggacggaacaccacacagaggcacaggctggacatccagatg
attatgatcatgaacggaaccctctacattgctgctagggaccatatttatactgttgat
atagacacatcacacacggaagaaatttattgtagcaaaaaactgacatggaaatctaga
caggccgatgtagacacatgcagaatgaagggaaaacataaggatgagtgccacaacttt
attaaagttcttctaaagaaaaacgatgatgcattgtttgtctgtggaactaatgccttc
aacccttcctgcagaaactataagatggatacattggaaccattcggggatgaattcagc
ggaatggccagatgcccatatgatgccaaacatgccaacgttgcactgtttgcagatgga
aaactatactcagccacagtgactgacttccttgccattgacgcagtcatttaccggagt
cttggagaaagccctaccctgcggaccgtcaagcacgattcaaaatggttgaaagaacca
tactttgttcaagccgtggattacggagattatatctacttcttcttcagggaaatagca
gtggagtataacaccatgggaaaggtagttttcccaagagtggctcaggtttgtaagaat
gatatgggaggatctcaaagagtcctggagaaacagtggacgtcgttcctgaaggcgcgc
ttgaactgctcagttcctggagactctcatttttatttcaacattctccaggcagttaca
gatgtgattcgtatcaacgggcgtgatgttgtcctggcaacgttttctacaccttataac
agcatccctgggtctgcagtctgtgcctatgacatgcttgacattgccagtgtttttact
gggagattcaaggaacagaagtctcctgattccacctggacaccagttcctgatgaacga
gttcctaagcccaggccaggttgctgtgctggctcatcctccttagaaagatatgcaacc
tccaatgagttccctgatgataccctgaacttcatcaagacgcacccgctcatggatgag
gcagtgccctccatcttcaacaggccatggttcctgagaacaatggtcagataccgcctt
accaaaattgcagtggacacagctgctgggccatatcagaatcacactgtggtttttctg
ggatcagagaagggaatcatcttgaagtttttggccagaataggaaatagtggttttcta
aatgacagccttttcctggaggagatgagtgtttacaactctgaaaaatgcagctatgat
ggagtcgaagacaaaaggatcatgggcatgcagctggacagagcaagcagctctctgtat
gttgcgttctctacctgtgtgataaaggttccccttggccggtgtgaacgacatgggaag
tgtaaaaaaacctgtattgcctccagagacccatattgtggatggataaaggaaggtggt
gcctgcagccatttatcacccaacagcagactgacttttgagcaggacatagagcgtggc
aatacagatggtctgggggactgtcacaattcctttgtggcactgaatgggcattccagt
tccctcttgcccagcacaaccacatcagattcgacggctcaagaggggtatgagtctagg
ggaggaatgctggactggaagcatctgcttgactcacctgacagcacagaccctttgggg
gcagtgtcttcccataatcaccaagacaagaagggagtgattcgggaaagttacctcaaa
ggccacgaccagctggttcccgtcaccctcttggccattgcagtcatcctggctttcgtc
atgggggccgtcttctcgggcatcaccgtctactgcgtctgtgatcatcggcgcaaagac
gtggctgtggtgcagcgcaaggagaaggagctcacccactcgcgccggggctccatgagc
agcgtcaccaagctcagcggcctctttggggacactcaatccaaagacccaaagccggag
gccatcctcacgccactcatgcacaacggcaagctcgccactcccggcaacacggccaag
atgctcattaaagcagaccagcaccacctggacctgacggccctccccaccccagagtca
accccaacgctgcagcagaagcggaagcccagccgcggcagccgcgagtgggagaggaac
cagaacctcatcaatgcctgcacaaaggacatgccccccatgggctcccctgtgattccc
acggacctgcccctgcgggcctcccccagccacatccccagcgtggtggtcctgcccatc
acgcagcagggctaccagcatgagtacgtggaccagcccaaaatgagcgaggtggcccag
atggcgctggaggaccaggccgccacactggagtataagaccatcaaggaacatctcagc
agcaagagtcccaaccatggggtgaaccttgtggagaacctggacagcctgccccccaaa
gttccacagcgggaggcctccctgggtcccccgggagcctccctgtctcagaccggtcta
agcaagcggctggaaatgcaccactcctcttcctacggggttgactataagaggagctac
cccacgaactcgctcacgagaagccaccaggccaccactctcaaaagaaacaacactaac
tcctccaattcctctcacctctccagaaaccagagctttggcaggggagacaacccgccg
cccgccccgcagagggtggactccatccaggtgcacagctcccagccatctggccaggcc
gtgactgtctcgaggcagcccagcctcaacgcctacaactcactgacaaggtcggggctg
aagcgtacgccctcgctaaagccggacgtaccccccaaaccatcctttgctcccctttcc
acatccatgaagcccaatgatgcgtgtacataa

KEGG   Homo sapiens (human): 80031
Entry
80031             CDS       T01001                                 

Symbol
SEMA6D
Name
(RefSeq) semaphorin 6D
  KO
K06842  semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    80031 (SEMA6D)
SSDB
Motif
Pfam: Sema PSI FixO
Other DBs
NCBI-GeneID: 80031
NCBI-ProteinID: NP_705871
OMIM: 609295
HGNC: 16770
Ensembl: ENSG00000137872
Vega: OTTHUMG00000172110
Pharos: Q8NFY4(Tbio)
UniProt: Q8NFY4
Position
15q21.1
AA seq 1073 aa
MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR
LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAE
NEEDKKVISLQLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGS
CGRVTPGMLAEGYEQDTEFGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTM
ASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVH
MNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLNGL
FDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAALPTPESTPVL
HQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS
FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDI
QMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLER
QRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVH
LQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYTY
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgagggtcttcctgctttgtgcctacatactgctgctgatggtttcccagttgagggca
gtcagctttcctgaagatgatgaaccccttaatactgtcgactatcactattcaaggcaa
tatccggtttttagaggacgcccttcaggcaatgaatcgcagcacaggctggactttcag
ctgatgttgaaaattcgagacacactttatattgctggcagggatcaagtttatacagta
aacttaaatgaaatgcccaaaacagaagtaatacccaacaagaaactgacatggcgatca
agacaacaggatcgagaaaactgtgctatgaaaggcaagcataaagatgaatgccacaac
tttatcaaagtatttgttccaagaaacgatgagatggtttttgtttgtggtaccaatgca
ttcaatcccatgtgtagatactacaggttgagtaccttagaatatgatggggaagaaatt
agtggcctggcaagatgcccatttgatgccagacaaaccaatgttgccctctttgctgat
gggaagctgtattctgccacagtggctgacttcttggccagcgatgccgttatttatcga
agcatgggtgatggatctgcccttcgcacaataaaatatgattccaaatggataaaagag
ccacactttcttcatgccatagaatatggaaactatgtctatttcttctttcgagaaatc
gctgtcgaacataataatttaggcaaggctgtgtattcccgcgtggcccgcatatgtaaa
aacgacatgggtggttcccagcgggtcctggagaaacactggacttcatttctaaaggct
cggctgaactgttctgtccctggagattcgtttttctactttgatgttctgcagtctatt
acagacataatacaaatcaatggcatccccactgtggtcggggtgtttaccacgcagctc
aatagcatccctggttctgctgtctgtgcatttagcatggatgacattgaaaaagtattc
aaaggacggtttaaggaacagaaaactccagattctgtttggacagcagttcccgaagac
aaagtgccaaagccaaggcctggctgttgtgcaaaacacggccttgccgaagcttataaa
acctccatcgatttcccggatgaaactctgtcattcatcaaatctcatcccctgatggac
tctgccgttccacccattgccgatgagccctggttcacaaagactcgggtcaggtacaga
ctgacggccatctcagtggaccattcagccggaccctaccagaactacacagtcatcttt
gttggctctgaagctggcatggtacttaaagttctggcaaagaccagtcctttctctttg
aacgacagcgtattactggaagagattgaagcctacaaccatgcaaagtgcagtgctgag
aatgaggaagacaaaaaggtcatctcattacagttggataaagatcaccacgctttatat
gtggcgttctctagctgcattatccgcatccccctcagtcgctgtgagcgttatggatca
tgtaaaaagtcttgtattgcatctcgtgacccgtattgtggctggttaagccagggatcc
tgtggtagagtgaccccagggatgcttgctgaaggatatgaacaagacacagaattcggc
aacacagctcatctaggggactgccatgaaattttgcctacttcaactacaccagattac
aaaatatttggcggtccaacatctgacatggaggtatcttcatcttctgttaccacaatg
gcaagtatcccagaaatcacacctaaagtgattgatacctggagacctaaactgacaagc
tctcggaaatttgtagttcaagatgatccaaacacttctgattttactgatcctttatcg
ggtatcccaaagggtgtacgatgggaagtccagtctggagagtccaaccagatggtccac
atgaatgtcctcatcacctgtgtctttgctgcttttgttttgggggcattcattgcaggt
gtggcagtatactgctatcgagacatgtttgttcggaaaaacagaaagatccataaagat
gcagagtccgcccagtcatgcacagactccagtggaagttttgccaaactgaatggtctc
tttgacagccctgtcaaggaataccaacagaatattgattctcctaaactgtatagtaac
ctgctaaccagtcggaaagagctaccacccaatggagatactaaatccatggtaatggac
catcgagggcaacctccagagttggctgctcttcctactcctgagtctacacccgtgctt
caccagaagaccctgcaggccatgaagagccactcagaaaaggcccatggccatggagct
tcaaggaaagaaacccctcagttttttccgtctagtccgccacctcattccccattaagt
catgggcatatccccagtgccattgttcttccaaatgctacccatgactacaacacgtct
ttctcaaactccaatgctcacaaagctgaaaagaagcttcaaaacattgatcaccctctc
acaaagtcatccagtaagagagatcaccggcgttctgttgattccagaaataccctcaat
gatctcctgaagcatctgaatgacccaaatagtaaccccaaagccatcatgggagacatc
cagatggcacaccagaacttaatgctggatcccatgggatcgatgtctgaggtcccacct
aaagtccctaaccgggaggcatcgctatactcccctccttcaactctccccagaaatagc
ccaaccaagcgagtggatgtccccaccactcctggagtcccaatgacttctctggaaaga
caaagaggttatcacaaaaattcctcccagaggcactctatatctgctatgcctaaaaac
ttaaactcaccaaatggtgttttgttatccagacagcctagtatgaaccgtggaggatat
atgcccacccccactggggcgaaggtggactatattcagggaacaccagtgagtgttcat
ctgcagccttccctctccagacagagcagctacaccagtaatggcactcttcctaggacg
ggactaaagaggacgccgtccttaaaacctgacgtgccaccaaagccttcctttgttcct
caaaccccatctgtcagaccactgaacaaatacacatactag

DBGET integrated database retrieval system