KEGG   Homo sapiens (human): 10505
Entry
10505             CDS       T01001                                 

Symbol
SEMA4F, M-SEMA, PRO2353, S4F, SEMAM, SEMAW, m-Sema-M
Name
(RefSeq) ssemaphorin 4F
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    10505 (SEMA4F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10505 (SEMA4F)
CD molecules [BR:hsa04090]
 Proteins
  10505 (SEMA4F)
SSDB
Motif
Pfam: Sema PSI PSI_integrin CcmD CbiM
Other DBs
NCBI-GeneID: 10505
NCBI-ProteinID: NP_004254
OMIM: 603706
HGNC: 10734
Ensembl: ENSG00000135622
Vega: OTTHUMG00000129952
Pharos: O95754(Tbio)
UniProt: O95754
Position
2p13.1
AA seq 770 aa
MPASAARPRPGPGQPTASPFPLLLLAVLSGPVSGRVPRSVPRTSLPISEADSCLTRFAVP
HTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGERPRRIDWMVPEAHRQNCRKKGKKED
ECHNFVQILAIANASHLLTCGTFAFDPKCGVIDVSRFQQVERLESGRGKCPFEPAQRSAA
VMAGGVLYAATVKNYLGTEPIITRAVGRAEDWIRTDTLPSWLNAPAFVAAVALSPAEWGD
EDGDDEIYFFFTETSRAFDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKADLLCPGP
EHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRE
LKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
ADGHPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSVLEDLAL
FPEPQPVENMKLYHSWLLVGSRTEVTQVNTTNCGRLQSCSECILAQDPVCAWSFRLDECV
AHAGEHRGLVQDIESADVSSLCPKEPGERPVVFEVPVATAAHVVLPCSPSSAWASCVWHQ
PSGVTALTPRRDGLEVVVTPGAMGAYACECQEGGAAHVVAAYSLVWGSQRDAPSRAHTVG
AGLAGFFLGILAASLTLILIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYSQDPPSPS
PEDERLPLALAKRGSGFGGFSPPFLLDPCPSPAHIRLTGAPLATCDETSI
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgccggcctctgctgcgcggccccgcccgggtcccgggcagcctacagcctcgcccttc
ccgctactgctgctggcggtgctgagcggcccggtatccggccgcgtcccccgctcggtg
cccagaacctcgcttccaatctctgaggctgactcctgtctcacccggttcgcagtccct
cacacatacaattactctgttctccttgtggatcctgcctcccacacactttatgttggc
gcccgggacaccatcttcgctttatccctgcccttctcaggggagagaccccgcaggatt
gactggatggttcctgaggctcacagacagaactgtaggaagaaaggcaagaaagaggac
gaatgtcacaattttgtccagattctcgccattgccaatgcctctcacctcctcacttgt
ggcaccttcgcttttgatccgaagtgcggggttattgatgtgtccaggttccagcaggtt
gaaagacttgagagtggccgggggaaatgtccttttgagccagctcagcggtcagcagct
gtaatggctgggggggtcctctatgctgccactgtgaaaaactacctggggacggagcca
attatcaccagagcagtgggtcgtgccgaggactggattcggacagataccttgccttcc
tggctgaacgccccagcctttgtcgcagccgtggccttgagcccagccgaatggggggat
gaagatggagacgacgaaatctacttcttctttacggagacttcccgagcatttgactca
tacgagcgcattaaagtcccacgggtggcccgtgtgtgtgcgggggacctcgggggccgg
aagaccctccagcagagatggacgacgtttttgaaagctgacctgctctgtccagggcct
gagcatggccgggcctccagtgtcctgcaggatgttgctgtgcttcgacctgagcttggg
gcagggactcccatcttttatggcatcttttcttcccagtgggagggggctactatctct
gctgtctgtgccttccgaccacaagacattcggacagtgctgaatggtcccttcagagaa
ctaaaacatgactgcaacagaggactgcctgtcgtggacaatgatgtgccccagcccaga
cctggagagtgcatcaccaacaacatgaagctccggcactttggctcatctctctccctg
cctgaccgcgtactcaccttcatccgggaccacccactcatggacaggccagtgtttcca
gctgatggccaccccctgctggtcactacagatacagcctatctcagagtcgtggcccac
agggtgaccagcctctcagggaaagagtatgatgtgctctacctggggacagaggatgga
cacctccaccgagcagtgcggatcggagctcagctcagcgttcttgaagatctggcctta
ttcccagagccacagccagttgagaacatgaaattgtaccacagctggctcctggttggc
tcccgtactgaggtgacacaagtgaatacaaccaactgtggccgtctccagagctgctca
gagtgcatcctggcccaggacccagtctgtgcctggagcttccggctggatgagtgtgtg
gcccatgccggggagcaccgagggttggtccaagacatagagtcagcagatgtctcctct
ttgtgtcctaaagagcctggagaacgtccagtagtgtttgaagttcccgtggctacagct
gcgcatgtggtcttgccatgttctccaagctcagcatgggcatcctgtgtgtggcaccag
cccagtggagtgactgcactcaccccccggcgggatggactggaggtggtggtgacccca
ggggccatgggcgcttatgcctgtgaatgtcaggagggtggggcagcccatgtggtagca
gcttacagcttggtatggggcagccagcgagatgctccgagccgggcccacacagtgggg
gcgggactggctggcttcttcttggggattctcgcagcatccctgactctcattctgatt
ggtcggcgtcagcagcgacggcgacagagggaacttctggctagagacaaggtgggcctg
gacctgggggctccaccttctgggaccacaagctacagccaagaccctccctccccctct
cctgaagatgagcggttgccgctggccctggccaagaggggcagtggctttggtggattc
tcaccacccttcctgcttgatccttgcccaagcccagcccacattcggctaactggggct
cctctagccacatgtgatgaaacatccatctag

KEGG   Homo sapiens (human): 10507
Entry
10507             CDS       T01001                                 

Symbol
SEMA4D, A8, BB18, C9orf164, CD100, COLL4, GR3, M-sema-G, SEMAJ, coll-4
Name
(RefSeq) semaphorin 4D
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Pepinemab: D11469
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    10507 (SEMA4D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10507 (SEMA4D)
CD molecules [BR:hsa04090]
 Proteins
  10507 (SEMA4D)
SSDB
Motif
Pfam: Sema ig PSI Ig_3 Ig_5 Ig_2 DUF3891 I-set
Other DBs
NCBI-GeneID: 10507
NCBI-ProteinID: NP_006369
OMIM: 601866
HGNC: 10732
Ensembl: ENSG00000187764
Vega: OTTHUMG00000020185
Pharos: Q92854(Tbio)
UniProt: Q92854
Structure
PDB: 
1OLZ 3OL2

Position
9q22.2
AA seq 862 aa
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgaggatgtgcacccccattagggggctgctcatggcccttgcagtgatgtttgggaca
gcgatggcatttgcacccataccccggatcacctgggagcacagagaggtgcacctggtg
cagtttcatgagccagacatctacaactactcagccttgctgctgagcgaggacaaggac
accttgtacataggtgcccgggaggcggtcttcgctgtgaacgcactcaacatctccgag
aagcagcatgaggtgtattggaaggtctcagaagacaaaaaagcaaaatgtgcagaaaag
gggaaatcaaaacagacagagtgcctcaactacatccgggtgctgcagccactcagcgcc
acttccctttacgtgtgtgggaccaacgcattccagccggcctgtgaccacctgaactta
acatcctttaagtttctggggaaaaatgaagatggcaaaggaagatgtccctttgaccca
gcacacagctacacatccgtcatggttgatggagaactttattcggggacgtcgtataat
tttttgggaagtgaacccatcatctcccgaaattcttcccacagtcctctgaggacagaa
tatgcaatcccttggctgaacgagcctagtttcgtgtttgctgacgtgatccgaaaaagc
ccagacagccccgacggcgaggatgacagggtctacttcttcttcacggaggtgtctgtg
gagtatgagtttgtgttcagggtgctgatcccacggatagcaagagtgtgcaagggggac
cagggcggcctgaggaccttgcagaagaaatggacctccttcctgaaagcccgactcatc
tgctcccggccagacagcggcttggtcttcaatgtgctgcgggatgtcttcgtgctcagg
tccccgggcctgaaggtgcctgtgttctatgcactcttcaccccacagctgaacaacgtg
gggctgtcggcagtgtgcgcctacaacctgtccacagccgaggaggtcttctcccacggg
aagtacatgcagagcaccacagtggagcagtcccacaccaagtgggtgcgctataatggc
ccggtacccaagccgcggcctggagcgtgcatcgacagcgaggcacgggccgccaactac
accagctccttgaatttgccagacaagacgctgcagttcgttaaagaccaccctttgatg
gatgactcggtaaccccaatagacaacaggcccaggttaatcaagaaagatgtgaactac
acccagatcgtggtggaccggacccaggccctggatgggactgtctatgatgtcatgttt
gtcagcacagaccggggagctctgcacaaagccatcagcctcgagcacgctgttcacatc
atcgaggagacccagctcttccaggactttgagccagtccagaccctgctgctgtcttca
aagaagggcaacaggtttgtctatgctggctctaactcgggcgtggtccaggccccgctg
gccttctgtgggaagcacggcacctgcgaggactgtgtgctggcgcgggacccctactgc
gcctggagcccgcccacagcgacctgcgtggctctgcaccagaccgagagccccagcagg
ggtttgattcaggagatgagcggcgatgcttctgtgtgcccggataaaagtaaaggaagt
taccggcagcattttttcaagcacggtggcacagcggaactgaaatgctcccaaaaatcc
aacctggcccgggtcttttggaagttccagaatggcgtgttgaaggccgagagccccaag
tacggtcttatgggcagaaaaaacttgctcatcttcaacttgtcagaaggagacagtggg
gtgtaccagtgcctgtcagaggagagggttaagaacaaaacggtcttccaagtggtcgcc
aagcacgtcctggaagtgaaggtggttccaaagcccgtagtggcccccaccttgtcagtt
gttcagacagaaggtagtaggattgccaccaaagtgttggtggcatccacccaagggtct
tctcccccaaccccagccgtgcaggccacctcctccggggccatcacccttcctcccaag
cctgcgcccaccggcacatcctgcgaaccaaagatcgtcatcaacacggtcccccagctc
cactcggagaaaaccatgtatcttaagtccagcgacaaccgcctcctcatgtccctcttc
ctcttcttctttgttctcttcctctgcctctttttctacaactgctataagggatacctg
cccagacagtgcttgaaattccgctcggccctactaattgggaagaagaagcccaagtca
gatttctgtgaccgtgagcagagcctgaaggagacgttagtagagccagggagcttctcc
cagcagaatggggagcaccccaagccagccctggacaccggctatgagaccgagcaagac
accatcaccagcaaagtccccacggatagggaggactcacagaggatcgacgacctttct
gccagggacaagccctttgacgtcaagtgtgagctgaagttcgctgactcagacgcagat
ggagactga

KEGG   Homo sapiens (human): 10509
Entry
10509             CDS       T01001                                 

Symbol
SEMA4B, SEMAC, SemC
Name
(RefSeq) semaphorin 4B
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    10509 (SEMA4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    10509 (SEMA4B)
CD molecules [BR:hsa04090]
 Proteins
  10509 (SEMA4B)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 10509
NCBI-ProteinID: NP_064595
OMIM: 617029
HGNC: 10730
Ensembl: ENSG00000185033
Vega: OTTHUMG00000172096
Pharos: Q9NPR2(Tbio)
UniProt: Q9NPR2
Position
15q26.1
AA seq 837 aa
MLRTAMGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWALSPRISLPLGSEERPFL
RFEAEHISNYTALLLSRDGRTLYVGAREALFALSSNLSFLPGGEYQELLWGADAEKKQQC
SFKGKDPQRDCQNYIKILLPLSGSHLFTCGTAAFSPMCTYINMENFTLARDEKGNVLLED
GKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESSLNWLQDPAF
VASAYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGERVLQQRW
TSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCV
FTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPTPRPGACITNSARERKINSSLQLPDRVL
NFLKDHFLMDGQVRSRMLLLQPQARYQRVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVG
PRVHIIEELQIFSSGQPVQNLLLDTHRGLLYAASHSGVVQVPMANCSLYRSCGDCLLARD
PYCAWSGSSCKHVSLYQPQLATRPWIQDIEGASAKDLCSASSVVSPSFVPTGEKPCEQVQ
FQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLE
EGFQQLVASYCPEVVEDGVADQTDEGGSVPVIISTSRVSAPAGGKASWGADRSYWKEFLV
MCTLFVLAVLLPVLFLLYRHRNSMKVFLKQGECASVHPKTCPVVLPPETRPLNGLGPPST
PLDHRGYQSLSDSPPGSRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgctgcgcaccgcgatgggcctgaggagctggctcgccgccccatggggcgcgctgccg
cctcggccaccgctgctgctgctcctgctgctgctgctcctgctgcagccgccgcctccg
acctgggcgctcagcccccggatcagcctgcctctgggctctgaagagcggccattcctc
agattcgaagctgaacacatctccaactacacagcccttctgctgagcagggatggcagg
accctgtacgtgggtgctcgagaggccctctttgcactcagtagcaacctcagcttcctg
ccaggcggggagtaccaggagctgctttggggtgcagacgcagagaagaaacagcagtgc
agcttcaagggcaaggacccacagcgcgactgtcaaaactacatcaagatcctcctgccg
ctcagcggcagtcacctgttcacctgtggcacagcagccttcagccccatgtgtacctac
atcaacatggagaacttcaccctggcaagggacgagaaggggaatgtcctcctggaagat
ggcaagggccgttgtcccttcgacccgaatttcaagtccactgccctggtggttgatggc
gagctctacactggaacagtcagcagcttccaagggaatgacccggccatctcgcggagc
caaagccttcgccccaccaagaccgagagctccctcaactggctgcaagacccagctttt
gtggcctcagcctacattcctgagagcctgggcagcttgcaaggcgatgatgacaagatc
tactttttcttcagcgagactggccaggaatttgagttctttgagaacaccattgtgtcc
cgcattgcccgcatctgcaagggcgatgagggtggagagcgggtgctacagcagcgctgg
acctccttcctcaaggcccagctgctgtgctcacggcccgacgatggcttccccttcaac
gtgctgcaggatgtcttcacgctgagccccagcccccaggactggcgtgacacccttttc
tatggggtcttcacttcccagtggcacaggggaactacagaaggctctgccgtctgtgtc
ttcacaatgaaggatgtgcagagagtcttcagcggcctctacaaggaggtgaaccgtgag
acacagcagtggtacaccgtgacccacccggtgcccacaccccggcctggagcgtgcatc
accaacagtgcccgggaaaggaagatcaactcatccctgcagctcccagaccgcgtgctg
aacttcctcaaggaccacttcctgatggacgggcaggtccgaagccgcatgctgctgctg
cagccccaggctcgctaccagcgcgtggctgtacaccgcgtccctggcctgcaccacacc
tacgatgtcctcttcctgggcactggtgacggccggctccacaaggcagtgagcgtgggc
ccccgggtgcacatcattgaggagctgcagatcttctcatcgggacagcccgtgcagaat
ctgctcctggacacccacagggggctgctgtatgcggcctcacactcgggcgtagtccag
gtgcccatggccaactgcagcctgtacaggagctgtggggactgcctcctcgcccgggac
ccctactgtgcttggagcggctccagctgcaagcacgtcagcctctaccagcctcagctg
gccaccaggccgtggatccaggacatcgagggagccagcgccaaggacctttgcagcgcg
tcttcggttgtgtccccgtcttttgtaccaacaggggagaagccatgtgagcaagtccag
ttccagcccaacacagtgaacactttggcctgcccgctcctctccaacctggcgacccga
ctctggctacgcaacggggcccccgtcaatgcctcggcctcctgccacgtgctacccact
ggggacctgctgctggtgggcacccaacagctgggggagttccagtgctggtcactagag
gagggcttccagcagctggtagccagctactgcccagaggtggtggaggacggggtggca
gaccaaacagatgagggtggcagtgtacccgtcattatcagcacatcgcgtgtgagtgca
ccagctggtggcaaggccagctggggtgcagacaggtcctactggaaggagttcctggtg
atgtgcacgctctttgtgctggccgtgctgctcccagttttattcttgctctaccggcac
cggaacagcatgaaagtcttcctgaagcagggggaatgtgccagcgtgcaccccaagacc
tgccctgtggtgctgccccctgagacccgcccactcaacggcctagggccccctagcacc
ccgctcgatcaccgagggtaccagtccctgtcagacagccccccggggtcccgagtcttc
actgagtcagagaagaggccactcagcatccaagacagcttcgtggaggtatccccagtg
tgcccccggccccgggtccgccttggctcggagatccgtgactctgtggtgtga

KEGG   Homo sapiens (human): 54910
Entry
54910             CDS       T01001                                 

Symbol
SEMA4C, M-SEMA-F, SEMACL1, SEMAF, SEMAI
Name
(RefSeq) semaphorin 4C
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    54910 (SEMA4C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    54910 (SEMA4C)
CD molecules [BR:hsa04090]
 Proteins
  54910 (SEMA4C)
SSDB
Motif
Pfam: Sema PSI Ig_2 Ig_3 I-set LapA_dom
Other DBs
NCBI-GeneID: 54910
NCBI-ProteinID: NP_060259
OMIM: 604462
HGNC: 10731
Ensembl: ENSG00000168758
Vega: OTTHUMG00000130535
Pharos: Q9C0C4(Tbio)
UniProt: Q9C0C4
Position
2q11.2
AA seq 833 aa
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggccccacactgggctgtctggctgctggcagcaaggctgtggggcctgggcattggg
gctgaggtgtggtggaaccttgtgccgcgtaagacagtgtcttctggggagctggccacg
gtagtacggcggttctcccagaccggcatccaggacttcctgacactgacgctgacggag
cccactgggcttctgtacgtgggcgcccgagaggccctgtttgccttcagcatggaggcc
ctggagctgcaaggagcgatctcctgggaggcccccgtggagaagaagactgagtgtatc
cagaaagggaagaacaaccagaccgagtgcttcaacttcatccgcttcctgcagccctac
aatgcctcccacctgtacgtctgtggcacctacgccttccagcccaagtgcacctacgtc
aacatgctcaccttcactttggagcatggagagtttgaagatgggaagggcaagtgtccc
tatgacccagctaagggccatgctggccttcttgtggatggtgagctgtactcggccaca
ctcaacaacttcctgggcacggaacccattatcctgcgtaacatggggccccaccactcc
atgaagacagagtacctggccttttggctcaacgaacctcactttgtaggctctgcctat
gtacctgagagtgtgggcagcttcacgggggacgacgacaaggtctacttcttcttcagg
gagcgggcagtggagtccgactgctatgccgagcaggtggtggctcgtgtggcccgtgtc
tgcaagggcgatatggggggcgcacggaccctgcagaggaagtggaccacgttcctgaag
gcgcggctggcatgctctgccccgaactggcagctctacttcaaccagctgcaggcgatg
cacaccctgcaggacacctcctggcacaacaccaccttctttggggtttttcaagcacag
tggggtgacatgtacctgtcggccatctgtgagtaccagttggaagagatccagcgggtg
tttgagggcccctataaggagtaccatgaggaagcccagaagtgggaccgctacactgac
cctgtacccagccctcggcctggctcgtgcattaacaactggcatcggcgccacggctac
accagctccctggagctacccgacaacatcctcaacttcgtcaagaagcacccgctgatg
gaggagcaggtggggcctcggtggagccgccccctgctcgtgaagaagggcaccaacttc
acccacctggtggccgaccgggttacaggacttgatggagccacctatacagtgctgttc
attggcacaggagacggctggctgctcaaggctgtgagcctggggccctgggttcacctg
attgaggagctgcagctgtttgaccaggagcccatgagaagcctggtgctatctcagagc
aagaagctgctctttgccggctcccgctctcagctggtgcagctgcccgtggccgactgc
atgaagtatcgctcctgtgcagactgtgtcctcgcccgggacccctattgcgcctggagc
gtcaacaccagccgctgtgtggccgtgggtggccactctggatctctactgatccagcat
gtgatgacctcggacacttcaggcatctgcaacctccgtggcagtaagaaagtcaggccc
actcccaaaaacatcacggtggtggcgggcacagacctggtgctgccctgccacctctcc
tccaacttggcccatgcccgctggacctttgggggccgggacctgcctgcggaacagccc
gggtccttcctctacgatgcccggctccaggccctggttgtgatggctgcccagccccgc
catgccggggcctaccactgcttttcagaggagcagggggcgcggctggctgctgaaggc
taccttgtggctgtcgtggcaggcccgtcggtgaccttggaggcccgggcccccctggaa
aacctggggctggtgtggctggcggtggtggccctgggggctgtgtgcctggtgctgctg
ctgctggtgctgtcattgcgccggcggctgcgggaagagctggagaaaggggccaaggct
actgagaggaccttggtgtaccccctggagctgcccaaggagcccaccagtccccccttc
cggccctgtcctgaaccagatgagaaactttgggatcctgtcggttactactattcagat
ggctcccttaagatagtacctgggcatgcccggtgccagcccggtggggggcccccttcg
ccacctccaggcatcccaggccagcctctgccttctccaactcggcttcacctggggggt
gggcggaactcaaatgccaatggttacgtgcgcttacaactaggaggggaggaccgggga
gggctcgggcaccccctgcctgagctcgcggatgaactgagacgcaaactgcagcaacgc
cagccactgcccgactccaaccccgaggagtcatcagtatga

KEGG   Homo sapiens (human): 57715
Entry
57715             CDS       T01001                                 

Symbol
SEMA4G
Name
(RefSeq) semaphorin 4G
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    57715 (SEMA4G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    57715 (SEMA4G)
CD molecules [BR:hsa04090]
 Proteins
  57715 (SEMA4G)
SSDB
Motif
Pfam: Sema PSI Ig_2 Ig_3 ig Trp_oprn_chp
Other DBs
NCBI-GeneID: 57715
NCBI-ProteinID: NP_060363
OMIM: 618991
HGNC: 10735
Ensembl: ENSG00000095539
Vega: OTTHUMG00000018922
Pharos: Q9NTN9(Tdark)
UniProt: Q9NTN9
Position
10q24.31
AA seq 843 aa
MWGRLWPLLLSILTATAVPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNSTHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEETPMHWLNDAEFVFSVLVRESKASAVGDDDKVYY
FFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPLYE
TLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLAEIQAVFAGPYMEYQDGSR
RWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFRESQSV
ENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAATTI
ANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LLNGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATP
APAPKAPATPGAQLAPDVRLLYVLAIAALGGLCLILASSLLYVACLREGRRGRRRKYSLG
RASRAGGSAVQLQTVSGQCPGEEDEGDDEGAGGLEGSCLQIIPGEGAPAPPPPPPPPPPA
ELTNGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEQLDE
SSV
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgtgggggaggctctggcccctcctcctcagcatcctcacagcaactgcagtcccagga
ccctcactgcggagaccgtctagagaactagatgccacccctcggatgaccataccctat
gaagagctctctgggacccggcacttcaagggccaagcccagaactactcaacactgctg
ctggaggaggcctcagcaaggctgctggtgggagcccgaggtgccctgttctctctcagt
gccaacgacataggagatggggctcacaaagagatccactgggaagcctccccagagatg
caaagcaaatgtcatcaaaaagggaaaaacaaccagacggagtgctttaaccatgtgcgg
ttcctgcagcggctcaattctacccacctctatgcatgtgggactcacgccttccagccc
ctctgtgcagccattgatgctgaggccttcaccttgccaaccagcttcgaggaggggaag
gagaagtgtccttatgacccagcccgtggcttcacaggcctcatcattgatggaggcctc
tacacagccactaggtatgaattccggagcattcctgacatccgccggagccgccaccca
cactccctgagaactgaggagacaccaatgcattggctcaatgatgcggagtttgtgttc
tccgtcctcgtgcgggagagcaaggccagtgcagtgggtgatgatgacaaggtgtactac
ttcttcacggagcgtgccactgaggagggctctggcagcttcactcagagccgcagcagt
caccgtgtggcccgtgtggctcgtgtctgcaagggagacctgggagggaagaagatcctg
cagaagaagtggacttccttcctgaaagcccgtctcatctgccacattccactgtatgag
acactgcgtggggtctgcagcctggatgctgaaacctcaagccgtacacacttctatgca
gccttcacgctgagcacacagtggaagaccctggaggcctcagccatctgccgctatgac
ctggcagagatccaggctgtctttgcaggaccctatatggaataccaggatggttcccgg
cgctggggtcgctatgagggtggggtgcctgagccccggcctggctcgtgtatcacagat
tcattgcgcagccaaggctacaattcatcccaagacttgccatccctggtcctggacttt
gtaaagttgcacccactgatggctcggcccgttgtgcccacacgtggacggcccctgctg
ctcaagcgcaacatacgctacacacaccttacagggacacctgtcaccacgcctgctgga
cctacctatgacctgctctttctgggcacagctgatggctggatccacaaggccgtagtc
ctgggctctgggatgcacattattgaagagacacaagtgttcagggagtcccagtctgtg
gaaaatctagtcatctctctattgcagcacagcctctatgtgggggctcctagcggagtc
atccagctaccactctccagctgctcccgctaccgatcctgctatgactgcatcttggcc
cgagacccctactgtggctgggaccctggcacccatgcctgcgcagcagccaccaccata
gccaacaggtcccagggaagcaggacagcactgatacaggacatagagagaggaaatcga
ggctgtgagagcagcagggatacagggccaccaccaccactgaagacccgctctgtgctc
cggggtgatgatgtcctcctgccctgtgaccagccatccaacctggcccgggccttgtgg
ctactcaatgggagcatgggcctgagcgatgggcagggtggctaccgtgtgggcgtggac
gggctgctggttacagatgcacagcctgagcacagtggcaactatggctgctatgccgag
gaaaatggcctccgcaccctgctggcctcctatagtctcacagtccggccagccactcct
gccccagctccaaaagcccctgccacacctggggcacagctggcacctgatgtgagactg
ctctatgtgctagccattgccgcgcttggtggcctctgcctcatcctggcctcctccctc
ctctatgtggcctgtctgcgggaaggcagacgagggcgccgacggaaatactcactgggt
cgggccagccgggcaggaggatctgcggtgcaactgcagacagtctcaggccagtgtcct
ggagaggaagatgagggtgatgatgagggggctgggggcctggagggcagctgtctccag
atcatccctggggagggagccccagccccaccacccccaccgcccccaccgccaccggct
gagctgaccaatggcttggtggcactgcccagccggctgcggaggatgaatggcaatagc
tatgtgcttctgaggcagagcaacaatggagtaccagcagggccctgctccttcgccgag
gaactcagccgcatcctggaaaaaaggaagcacacgcagctcgtggagcagctagatgag
agctctgtctga

KEGG   Homo sapiens (human): 64218
Entry
64218             CDS       T01001                                 

Symbol
SEMA4A, CORD10, RP35, SEMAB, SEMB
Name
(RefSeq) semaphorin 4A
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00481  Cone-rod dystrophy and cone dystrophy
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    64218 (SEMA4A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    64218 (SEMA4A)
CD molecules [BR:hsa04090]
 Proteins
  64218 (SEMA4A)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 64218
NCBI-ProteinID: NP_001180229
OMIM: 607292
HGNC: 10729
Ensembl: ENSG00000196189
Vega: OTTHUMG00000014042
Pharos: Q9H3S1(Tbio)
UniProt: Q9H3S1
Position
1q22
AA seq 761 aa
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGA
VFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMER
GNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPE
ASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREH
VKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILVASPLRALRARGKVQGCE
TLRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTEVA
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggccctcccagccctgggcctggacccctggagcctcctgggccttttcctcttccaa
ctgcttcagctgctgctgccgacgacgaccgcggggggaggcgggcaggggcccatgccc
agggtcagatactatgcaggggatgaacgtagggcacttagcttcttccaccagaagggc
ctccaggattttgacactctgctcctgagtggtgatggaaatactctctacgtgggggct
cgagaagccattctggccttggatatccaggatccaggggtccccaggctaaagaacatg
ataccgtggccagccagtgacagaaaaaagagtgaatgtgcctttaagaagaagagcaat
gagacacagtgtttcaacttcatccgtgtcctggtttcttacaatgtcacccatctctac
acctgcggcaccttcgccttcagccctgcttgtaccttcattgaacttcaagattcctac
ctgttgcccatctcggaggacaaggtcatggagggaaaaggccaaagcccctttgacccc
gctcacaagcatacggctgtcttggtggatgggatgctctattctggtactatgaacaac
ttcctgggcagtgagcccatcctgatgcgcacactgggatcccagcctgtcctcaagacc
gacaacttcctccgctggctgcatcatgacgcctcctttgtggcagccatcccttcgacc
caggtcgtctacttcttcttcgaggagacagccagcgagtttgacttctttgagaggctc
cacacatcgcgggtggctagagtctgcaagaatgacgtgggcggcgaaaagctgctgcag
aagaagtggaccaccttcctgaaggcccagctgctctgcacccagccggggcagctgccc
ttcaacgtcatccgccacgcggtcctgctccccgccgattctcccacagctccccacatc
tacgcagtcttcacctcccagtggcaggttggcgggaccaggagctctgcggtttgtgcc
ttctctctcttggacattgaacgtgtctttaaggggaaatacaaagagttgaacaaagaa
acttcacgctggactacttataggggccctgagaccaacccccggccaggcagttgctca
gtgggcccctcctctgataaggccctgaccttcatgaaggaccatttcctgatggatgag
caagtggtggggacgcccctgctggtgaaatctggcgtggagtatacacggcttgcagtg
gagacagcccagggccttgatgggcacagccatcttgtcatgtacctgggaaccaccaca
gggtcgctccacaaggctgtggtaagtggggacagcagtgctcatctggtggaagagatt
cagctgttccctgaccctgaacctgttcgcaacctgcagctggcccccacccagggtgca
gtgtttgtaggcttctcaggaggtgtctggagggtgccccgagccaactgtagtgtctat
gagagctgtgtggactgtgtccttgcccgggacccccactgtgcctgggaccctgagtcc
cgaacctgttgcctcctgtctgcccccaacctgaactcctggaagcaggacatggagcgg
gggaacccagagtgggcatgtgccagtggccccatgagcaggagccttcggcctcagagc
cgcccgcaaatcattaaagaagtcctggctgtccccaactccatcctggagctcccctgc
ccccacctgtcagccttggcctcttattattggagtcatggcccagcagcagtcccagaa
gcctcttccactgtctacaatggctccctcttgctgatagtgcaggatggagttgggggt
ctctaccagtgctgggcaactgagaatggcttttcataccctgtgatctcctactgggtg
gacagccaggaccagaccctggccctggatcctgaactggcaggcatcccccgggagcat
gtgaaggtcccgttgaccagggtcagtggtggggccgccctggctgcccagcagtcctac
tggccccactttgtcactgtcactgtcctctttgccttagtgctttcaggagccctcatc
atcctcgtggcctccccattgagagcactccgggctcggggcaaggttcagggctgtgag
accctgcgccctggggagaaggccccgttaagcagagagcaacacctccagtctcccaag
gaatgcaggacctctgccagtgatgtggacgctgacaacaactgcctaggcactgaggta
gcttaa

DBGET integrated database retrieval system