KEGG   Homo sapiens (human): 10507Help
Entry
10507             CDS       T01001                                 

Gene name
SEMA4D, C9orf164, CD100, COLL4, M-sema-G, SEMAJ, coll-4
Definition
(RefSeq) semaphorin 4D
  KO
K06521  semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    10507 (SEMA4D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    10507 (SEMA4D)
CD molecules [BR:hsa04090]
 Proteins
  10507 (SEMA4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema ig PSI Ig_3 Ig_5 Ig_2 V-set DUF3891 I-set PSI_integrin
Motif
Other DBs
NCBI-GeneID: 10507
NCBI-ProteinID: NP_006369
OMIM: 601866
HGNC: 10732
Ensembl: ENSG00000187764
Vega: OTTHUMG00000020185
Pharos: Q92854(Tbio)
UniProt: Q92854
Structure
PDB: 

Position
9q22.2
AA seq 862 aa AA seqDB search
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgcacccccattagggggctgctcatggcccttgcagtgatgtttgggaca
gcgatggcatttgcacccataccccggatcacctgggagcacagagaggtgcacctggtg
cagtttcatgagccagacatctacaactactcagccttgctgctgagcgaggacaaggac
accttgtacataggtgcccgggaggcggtcttcgctgtgaacgcactcaacatctccgag
aagcagcatgaggtgtattggaaggtctcagaagacaaaaaagcaaaatgtgcagaaaag
gggaaatcaaaacagacagagtgcctcaactacatccgggtgctgcagccactcagcgcc
acttccctttacgtgtgtgggaccaacgcattccagccggcctgtgaccacctgaactta
acatcctttaagtttctggggaaaaatgaagatggcaaaggaagatgtccctttgaccca
gcacacagctacacatccgtcatggttgatggagaactttattcggggacgtcgtataat
tttttgggaagtgaacccatcatctcccgaaattcttcccacagtcctctgaggacagaa
tatgcaatcccttggctgaacgagcctagtttcgtgtttgctgacgtgatccgaaaaagc
ccagacagccccgacggcgaggatgacagggtctacttcttcttcacggaggtgtctgtg
gagtatgagtttgtgttcagggtgctgatcccacggatagcaagagtgtgcaagggggac
cagggcggcctgaggaccttgcagaagaaatggacctccttcctgaaagcccgactcatc
tgctcccggccagacagcggcttggtcttcaatgtgctgcgggatgtcttcgtgctcagg
tccccgggcctgaaggtgcctgtgttctatgcactcttcaccccacagctgaacaacgtg
gggctgtcggcagtgtgcgcctacaacctgtccacagccgaggaggtcttctcccacggg
aagtacatgcagagcaccacagtggagcagtcccacaccaagtgggtgcgctataatggc
ccggtacccaagccgcggcctggagcgtgcatcgacagcgaggcacgggccgccaactac
accagctccttgaatttgccagacaagacgctgcagttcgttaaagaccaccctttgatg
gatgactcggtaaccccaatagacaacaggcccaggttaatcaagaaagatgtgaactac
acccagatcgtggtggaccggacccaggccctggatgggactgtctatgatgtcatgttt
gtcagcacagaccggggagctctgcacaaagccatcagcctcgagcacgctgttcacatc
atcgaggagacccagctcttccaggactttgagccagtccagaccctgctgctgtcttca
aagaagggcaacaggtttgtctatgctggctctaactcgggcgtggtccaggccccgctg
gccttctgtgggaagcacggcacctgcgaggactgtgtgctggcgcgggacccctactgc
gcctggagcccgcccacagcgacctgcgtggctctgcaccagaccgagagccccagcagg
ggtttgattcaggagatgagcggcgatgcttctgtgtgcccggataaaagtaaaggaagt
taccggcagcattttttcaagcacggtggcacagcggaactgaaatgctcccaaaaatcc
aacctggcccgggtcttttggaagttccagaatggcgtgttgaaggccgagagccccaag
tacggtcttatgggcagaaaaaacttgctcatcttcaacttgtcagaaggagacagtggg
gtgtaccagtgcctgtcagaggagagggttaagaacaaaacggtcttccaagtggtcgcc
aagcacgtcctggaagtgaaggtggttccaaagcccgtagtggcccccaccttgtcagtt
gttcagacagaaggtagtaggattgccaccaaagtgttggtggcatccacccaagggtct
tctcccccaaccccagccgtgcaggccacctcctccggggccatcacccttcctcccaag
cctgcgcccaccggcacatcctgcgaaccaaagatcgtcatcaacacggtcccccagctc
cactcggagaaaaccatgtatcttaagtccagcgacaaccgcctcctcatgtccctcttc
ctcttcttctttgttctcttcctctgcctctttttctacaactgctataagggatacctg
cccagacagtgcttgaaattccgctcggccctactaattgggaagaagaagcccaagtca
gatttctgtgaccgtgagcagagcctgaaggagacgttagtagagccagggagcttctcc
cagcagaatggggagcaccccaagccagccctggacaccggctatgagaccgagcaagac
accatcaccagcaaagtccccacggatagggaggactcacagaggatcgacgacctttct
gccagggacaagccctttgacgtcaagtgtgagctgaagttcgctgactcagacgcagat
ggagactga

DBGET integrated database retrieval system