KEGG   Homo sapiens (human): 1051Help
Entry
1051              CDS       T01001                                 

Gene name
CEBPB, C/EBP-beta, IL6DBP, NF-IL6, TCF5
Definition
(RefSeq) CCAAT enhancer binding protein beta
  KO
K10048  CCAAT/enhancer binding protein (C/EBP), beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
Network
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    1051 (CEBPB)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    1051 (CEBPB)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    1051 (CEBPB)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    1051 (CEBPB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1051 (CEBPB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1051 (CEBPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 CCD48 ATG16 DUF3450 bZIP_Maf DivIC UPF0242
Motif
Other DBs
NCBI-GeneID: 1051
NCBI-ProteinID: NP_005185
OMIM: 189965
HGNC: 1834
Ensembl: ENSG00000172216
Vega: OTTHUMG00000032715
Pharos: P17676(Tbio)
UniProt: P17676
Structure
PDB: 

Position
20q13.13
AA seq 345 aa AA seqDB search
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcctggtggcctgggacccagcatgtctccccctgccgccgccgccgcctgcc
tttaaatccatggaagtggccaacttctactacgaggcggactgcttggctgctgcgtac
ggcggcaaggcggcccccgcggcgccccccgcggccagacccgggccgcgcccccccgcc
ggcgagctgggcagcatcggcgaccacgagcgcgccatcgacttcagcccgtacctggag
ccgctgggcgcgccgcaggccccggcgcccgccacggccacggacaccttcgaggcggct
ccgcccgcgcccgcccccgcgcccgcctcctccgggcagcaccacgacttcctctccgac
ctcttctccgacgactacgggggcaagaactgcaagaagccggccgagtacggctacgtg
agcctggggcgcctgggggccgccaagggcgcgctgcaccccggctgcttcgcgcccctg
cacccaccgcccccgccgccgccgccgcccgccgagctcaaggcggagccgggcttcgag
cccgcggactgcaagcggaaggaggaggccggggcgccgggcggcggcgcaggcatggcg
gcgggcttcccgtacgcgctgcgcgcttacctcggctaccaggcggtgccgagcggcagc
agcgggagcctctccacgtcctcctcgtccagcccgcccggcacgccgagccccgctgac
gccaaggcgcccccgaccgcctgctacgcgggggccgcgccggcgccctcgcaggtcaag
agcaaggccaagaagaccgtggacaagcacagcgacgagtacaagatccggcgcgagcgc
aacaacatcgccgtgcgcaagagccgcgacaaggccaagatgcgcaacctggagacgcag
cacaaggtcctggagctcacggccgagaacgagcggctgcagaagaaggtggagcagctg
tcgcgcgagctcagcaccctgcggaacttgttcaagcagctgcccgagcccctgctcgcc
tcctccggccactgctag

DBGET integrated database retrieval system