KEGG   Homo sapiens (human): 10514
Entry
10514             CDS       T01001                                 

Gene name
MYBBP1A, P160, PAP2, Pol5
Definition
(RefSeq) MYB binding protein 1a
  KO
K02331  DNA polymerase phi [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10514 (MYBBP1A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10514 (MYBBP1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     10514 (MYBBP1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    10514 (MYBBP1A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   DNA polymerases
    10514 (MYBBP1A)
SSDB
Motif
Pfam: DNA_pol_phi
Other DBs
NCBI-GeneID: 10514
NCBI-ProteinID: NP_055335
OMIM: 604885
HGNC: 7546
Ensembl: ENSG00000132382
Vega: OTTHUMG00000090747
Pharos: Q9BQG0(Tbio)
UniProt: Q9BQG0
Position
17p13.2
AA seq 1328 aa
MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEY
LRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYD
LHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKA
LVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFS
DENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWP
ASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFL
EGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLD
SLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCL
FHSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQP
WTYHLVQFADLLLNHSHNVTTVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLL
LVGIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLA
QPSHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAE
DKSEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKALGGEDSENEEE
LGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQP
ENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGAL
HAQVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMP
TGPQAASCLDLNLVTRVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHI
TGPVRPRHQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQ
QALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMK
TLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAAT
GGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQ
VNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKA
QVRKAGKP
NT seq 3987 nt   +upstreamnt  +downstreamnt
atggagagccgggatcccgcccagccgatgtcgcctggagaagcgacgcagagtggcgcc
cggcctgccgaccgctatggcctattgaagcacagtcgcgagttcttggacttcttctgg
gacattgcgaagcctgagcaggagacgcgacttgcggccacggagaagctgctggagtat
ctgcgtggcaggccgaaggggtccgagatgaaatatgccctgaagcgtctaatcacggga
ctcggggtcgggcgagaaacagcccggccctgctacagtttggccctggcacagctgtta
cagtcttttgaagacctccccttgtgcagcatcctgcagcagatacaagaaaaatatgac
ctgcatcaggtgaagaaggcaatgctgagacctgctctctttgcaaacctgtttggagtg
ctcgccctctttcagtcaggtcggctggtgaaggaccaggaggcactgatgaagtcggtg
aagctgctgcaggccctggcccagtaccaaaaccacttgcaggagcagccccggaaggcc
ctggtggacatcctctccgaggtctcgaaggccacattgcaggagatcctgccggaggtc
ctcaaagccgacttgaatataatactcagctcccctgaacagctagagctcttcctcctg
gcccagcagaaggtgccctccaagctcaagaagctggtgggatccgtgaacctattctca
gatgagaatgtccccaggctggtgaatgtgctgaagatggccgcctcctctgtgaagaag
gaccgcaagctgcccgccattgctctggacctgctccgcctggcactcaaggaagacaag
ttcccacggttctggaaggaggtggtggaacaagggctgctgaagatgcagttctggcca
gccagctacctgtgtttccgcctgctgggcgcggccctgcccctgctgaccaaggagcag
ctgcacctggtgatgcagggagacgtgatccgccattacggggagcacgtgtgcactgct
aagctcccaaagcagttcaagtttgccccagagatggacgattacgtgggcaccttccta
gaggggtgccaggatgaccctgagcggcagctggccgtgctagtggccttctcatctgtc
accaaccaaggcctccctgtcacgcctactttctggcgggtcgtgcggttcctgagccct
ccggccctgcagggctatgtggcctggctgcgggccatgtttctccagccagacctggac
tccttggttgacttcagcaccaacaaccagaagaaagcccaggattcatcgctccacatg
cctgagcgagctgtgttccggctgaggaaatggatcatctttcgattggtgagcattgtg
gacagcctgcacctggagatggaggaggccttgactgagcaggtggccaggttttgtttg
ttccactcgttctttgtcacaaagaagcccacatcccagatccctgagacaaagcacccg
ttctccttccctttggaaaaccaggcccgagaggctgtcagcagtgccttcttcagtctg
ttgcagaccctcagcacgcagttcaagcaggcaccgggccagacccagggtgggcagccc
tggacctaccacctggtgcagttcgcagacctcctgttgaatcacagccacaacgtgacc
accgtgacacccttcactgcgcagcagcgccaggcctgggaccggatgctgcagactctg
aaggagctggaggcccactccgcagaggccagggctgctgccttccagcaccttctgctc
ctcgtgggcatccacctcctcaagtcccctgcagagagctgtgacctgctgggtgacatc
cagacctgcatcaggaaaagtctgggagagaagccccgccggagccgcaccaagaccatc
gacccccaggaacccccgtgggtagaggtgctggtggagatcttgctggccctgttggcc
cagcccagccacctcatgcgccaggtggcccggagcgtgtttggccacatctgctcccac
ctgaccccgcgtgccctgcagctaattctggatgtgctgaaccccgagaccagtgaggat
gagaatgaccgtgtggtggtgacggacgattctgatgagcggcggctgaagggtgcagag
gacaagagcgaggaaggtgaggacaacagaagctcagagagtgaagaggagagcgagggg
gaggagagcgaggaggaggagcgcgacggggacgtggatcagggcttccgggaacagctg
atgaccgtgctgcaggctgggaaggcgctgggtggagaggacagtgagaacgaggaggag
ctgggggatgaggccatgatggccctggaccagagcctcgccagcctctttgccgagcag
aagctgcgtatccaggcccggcgagacgagaagaacaagctgcagaaggagaaggctctg
cggcgcgacttccagatccgggtgctggacctggtggaggtgctagtgaccaagcagccc
gagaatgccctggtcctggagctgctggagccgctgctgagcatcatccggcgcagcctg
cgcagcagcagctccaaacaggagcaggaccttctgcacaagacggcgcgcatcttcacg
caccacctgtgccgtgcccggcgctactgccacgacttgggtgagcgcgcaggggccctg
cacgcccaggtggagcggttggtgcagcaggctggccgccagcccgactcccccaccgcc
ctctaccacttcaacgcctctctctacctgctccgggtcttgaagggcaacactgctgag
ggctgcgtgcatgagacacaggagaagcagaaagctggcactgaccccagccacatgccc
acgggcccgcaggctgccagctgcttggacttgaacctggtgacccgggtgtactcgaca
gcactgagctccttcctgaccaagcgcaacagccccctcacagttcccatgttcctcagc
ctcttctcccggcacccggtgctctgtcagagcctgctccccatcctggtccagcatatc
acgggcccggtgcggccccgtcatcaggcctgcctgctgctccagaagaccctgtccatg
cgggaggtgaggtcgtgctttgaggaccccgagtggaagcagctgatgggccaggtccta
gcaaaggtcaccgagaacttgcgcgtgctgggggaggcgcagaccaaggcgcagcatcag
caggcactgtcctccctggagctgctcaacgttctcttcaggacctgcaaacatgagaag
ctgaccttggacctgacggtgctcctgggtgtgctgcaggggcaacagcagagcctacag
cagggggcacactccaccggctccagccgcctgcacgacctctactggcaggccatgaaa
accctgggagtccagcgccccaagttggagaagaaggatgccaaggagatccccagtgcc
acccagagccccatcagtaagaagcggaagaaaaagggattcttgccagagacgaagaag
cgcaagaaacgcaagtcagaggatggcacgccagcggaggatggcacacctgcagccacc
ggcgggagccagccccccagcatgggcaggaagaagaggaacaggacaaaggctaaggtc
ccagcccaggcaaacgggacgccaaccaccaagagtccagcccctggcgcccccacccgg
agccccagcacccctgccaaatccccaaaactgcagaagaaaaaccagaagccgtcccag
gtgaatggagctcccgggtcccccacggaacctgcaggccaaaagcagcatcagaaggct
cttcccaaaaagggggtcttgggcaaatcaccactgtccgcgctggcacggaaaaaggca
aggctgtctttggtcatcaggagtcccagcctgcttcagagtggggccaagaagaaagca
caggtgaggaaggcagggaagccctga

DBGET integrated database retrieval system