KEGG   Homo sapiens (human): 10519
Entry
10519             CDS       T01001                                 

Gene name
CIB1, CIB, CIBP, KIP1, PRKDCIP, SIP2-28
Definition
(RefSeq) calcium and integrin binding 1
  KO
K17259  calcium and integrin-binding protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00842  Epidermodysplasia verruciformis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10519 (CIB1)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    10519 (CIB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10519 (CIB1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   10519 (CIB1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 Dockerin_1 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 10519
NCBI-ProteinID: NP_006375
OMIM: 602293
HGNC: 16920
Ensembl: ENSG00000185043
Vega: OTTHUMG00000149808
Pharos: Q99828(Tbio)
UniProt: Q99828 A0A140VK09
Structure
PDB: 

Position
15q26.1
AA seq 191 aa
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggggctcgggcagtcgcctgtccaaggagctgctggccgagtaccaggacttgacg
ttcctgacgaagcaggagatcctcctagcccacaggcggttttgtgagctgcttccccag
gagcagcggagcgtggagtcgtcacttcgggcacaagtgcccttcgagcagattctcagc
cttccagagctcaaggccaaccccttcaaggagcgaatctgcagggtcttctccacatcc
ccagccaaagacagccttagctttgaggacttcctggatctcctcagtgtgttcagtgac
acagccacgccagacatcaagtcccattatgccttccgcatctttgactttgatgatgac
ggaaccttgaacagagaagacctgagccggctggtgaactgcctcacgggagagggcgag
gacacacggcttagtgcgtctgagatgaagcagctcatcgacaacatcctggaggagtct
gacattgacagggatggaaccatcaacctctctgagttccagcacgtcatctcccgttct
ccagactttgccagctcctttaagattgtcctgtga

DBGET integrated database retrieval system