KEGG   Homo sapiens (human): 1052Help
Entry
1052              CDS       T01001                                 

Gene name
CEBPD, C/EBP-delta, CELF, CRP3, NF-IL6-beta
Definition
(RefSeq) CCAAT enhancer binding protein delta
  KO
K10050  CCAAT/enhancer binding protein (C/EBP), delta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1052 (CEBPD)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1052 (CEBPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 ATG16 bZIP_1 FTA4 CASP_C BST2 GAS DUF1465 DivIC UPF0242 DUF2514 Lipoprotein_20
Motif
Other DBs
NCBI-GeneID: 1052
NCBI-ProteinID: NP_005186
OMIM: 116898
HGNC: 1835
Ensembl: ENSG00000221869
Vega: OTTHUMG00000162290
Pharos: P49716(Tbio)
UniProt: P49716
Position
8q11.21
AA seq 269 aa AA seqDB search
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRDLAGLRQFFKQLPSPPFLPAAGTADCR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgctcttcagcctggacggcccggcgcgcggcgcgccctggcctgcggag
cctgcgcccttctacgaaccgggccgggcgggcaagccgggccgcggggccgagccaggg
gccctaggcgagccaggcgccgccgcccccgccatgtacgacgacgagagcgccatcgac
ttcagcgcctacatcgactccatggccgccgtgcccaccctggagctgtgccacgacgag
ctcttcgccgacctcttcaacagcaatcacaaggcgggcggcgcggggcccctggagctt
cttcccggcggccccgcgcgccccttgggcccgggccctgccgctccccgcctgctcaag
cgcgagcccgactggggcgacggcgacgcgcccggctcgctgttgcccgcgcaggtggcc
gcgtgcgcacagaccgtggtgagcttggcggccgcagggcagcccaccccgcccacgtcg
ccggagccgccgcgcagcagccccaggcagacccccgcgcccggccccgcccgggagaag
agcgccggcaagaggggcccggaccgcggcagccccgagtaccggcagcggcgcgagcgc
aacaacatcgccgtgcgcaagagccgcgacaaggccaagcggcgcaaccaggagatgcag
cagaagttggtggagctgtcggctgagaacgagaagctgcaccagcgcgtggagcagctc
acgcgggacctggccggcctccggcagttcttcaagcagctgcccagcccgcccttcctg
ccggccgccgggacagcagactgccggtaa

DBGET integrated database retrieval system