KEGG   Homo sapiens (human): 10525Help
Entry
10525             CDS       T01001                                 

Gene name
HYOU1, GRP-170, Grp170, HSP12A, ORP-150, ORP150
Definition
(RefSeq) hypoxia up-regulated 1
  KO
K09486  hypoxia up-regulated 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10525 (HYOU1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10525 (HYOU1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP110
   10525 (HYOU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl AbiEi_3_N
Motif
Other DBs
NCBI-GeneID: 10525
NCBI-ProteinID: NP_001124463
OMIM: 601746
HGNC: 16931
Ensembl: ENSG00000149428
Vega: OTTHUMG00000166354
Pharos: Q9Y4L1(Tbio)
UniProt: Q9Y4L1 A0A384P5T6 B7Z602 B7Z766 Q6IN67 B3KXH0
Position
11q23.3
AA seq 999 aa AA seqDB search
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaagttaggaggcagaggccgaggaggcgagtctgttgggccttggtggct
gtgctcttggcagacctgttggcactgagtgatacactggcagtgatgtctgtggacctg
ggcagtgagtccatgaaggtggccattgtcaaacctggagtgcccatggaaattgtcttg
aataaggaatctcggaggaaaacaccggtgatcgtgaccctgaaagaaaatgaaagattc
tttggagacagtgcagcaagcatggcgattaagaatccaaaggctacgctacgttacttc
cagcacctcctggggaagcaggcagataacccccatgtagctctttaccaggcccgcttc
ccggagcacgagctgactttcgacccacagaggcagactgtgcactttcagatcagctcg
cagctgcagttctcacctgaggaagtgttgggcatggttctcaattattctcgttctcta
gctgaagattttgcagagcagcccatcaaggatgcagtgatcaccgtgccagtcttcttc
aaccaggccgagcgccgagctgtgctgcaggctgctcgtatggctggcctcaaagtgctg
cagctcatcaatgacaacaccgccactgccctcagctatggtgtcttccgccggaaagat
attaacaccactgcccagaatatcatgttctatgacatgggctcaggcagcaccgtatgc
accattgtgacctaccagatggtgaagactaaggaagctgggatgcagccacagctgcag
atccggggagtaggatttgaccgtaccctggggggcctggagatggagctccggcttcga
gaacgcctggctgggcttttcaatgagcagcgcaagggtcagagagcaaaggatgtgcgg
gagaacccgcgtgccatggccaagctgctgcgtgaggctaatcggctcaaaaccgtcctc
agtgccaacgctgaccacatggcacagattgaaggcctgatggatgatgtggacttcaag
gcaaaagtgactcgtgtggaatttgaggagttgtgtgcagacttgtttgagcgggtgcct
gggcctgtacagcaggccctccagagtgccgaaatgagtctggatgagattgagcaggtg
atcctggtgggtggggccactcgggtccccagagttcaggaggtgctgctgaaggccgtg
ggcaaggaggagctggggaagaacatcaatgcagatgaagcagccgccatgggggcagtg
taccaggcagctgcgctcagcaaagcctttaaagtgaagccatttgtcgtccgagatgca
gtggtctaccccatcctggtggagttcacgagggaggtggaggaggagcctgggattcac
agcctgaagcacaataaacgggtactcttctctcggatggggccctaccctcaacgcaaa
gtcatcacctttaaccgctacagccatgatttcaacttccacatcaactacggcgacctg
ggcttcctggggcctgaagatcttcgggtatttggctcccagaatctgaccacagtgaag
ctaaaaggggtgggtgacagcttcaagaagtatcctgactacgagtccaagggcatcaag
gctcacttcaacctggatgagagtggcgtgctcagtctagacagggtggagtctgtattt
gagacactggtagaggacagcgcagaagaggaatctactctcaccaaacttggcaacacc
atttccagcctgtttggaggcggtaccacaccagatgccaaggagaatggtactgatact
gtccaggaggaagaggagagccctgcagaggggagcaaggacgagcctggggagcaggtg
gagctcaaggaggaagctgaggccccagtggaggatggctctcagcccccaccccctgaa
cctaagggagatgcaacccctgagggagaaaaggccacagaaaaagaaaatggggacaag
tctgaggcccagaaaccaagtgagaaggcagaggcagggcctgagggcgtcgctccagcc
ccagagggagagaagaagcagaagcccgccaggaagcggcgaatggtagaggagatcggg
gtggagctggttgttctggacctgcctgacttgccagaggataagctggctcagtcggtg
cagaaacttcaggacttgacactccgagacctggagaagcaggaacgggaaaaagctgcc
aacagcttggaagcattcatatttgagacccaggacaagctgtaccagcccgagtaccag
gaagtgtccacagaggagcagcgtgaggagatctctgggaagctcagcgccgcatccacc
tggctggaggatgagggtgttggagccaccacagtgatgttgaaggagaagctggctgag
ctgaggaagctgtgccaagggctgttttttcgggtagaggagcgcaagaagtggcccgaa
cggctgtctgccctcgataatctcctcaaccattccagcatgttcctcaagggggcccgg
ctcatcccagagatggaccagatcttcactgaggtggagatgacaacgttagagaaagtc
atcaatgagacctgggcctggaagaatgcaactctggccgagcaggctaagctgcccgcc
acagagaagcctgtgttgctctcaaaagacattgaagctaagatgatggccctggaccga
gaggtgcagtatctgctcaataaggccaagtttaccaagccccggccccggcctaaggac
aagaatgggacccgggcagagccacccctcaatgccagtgccagtgaccagggggagaag
gtcatccctccagcaggccagactgaagatgcagagcccatttcagaacctgagaaagta
gagactggatccgagccaggagacactgagcctttggagttaggaggtcctggagcagaa
cctgaacagaaagaacaatcgacaggacagaagcggcctttgaagaacgacgaactataa

DBGET integrated database retrieval system