KEGG   Homo sapiens (human): 10525
Entry
10525             CDS       T01001                                 

Symbol
HYOU1, GRP-170, Grp170, HSP12A, IMD59, ORP-150, ORP150
Name
(RefSeq) hypoxia up-regulated 1
  KO
K09486  hypoxia up-regulated 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10525 (HYOU1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10525 (HYOU1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP110
   10525 (HYOU1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl AbiEi_3_N
Other DBs
NCBI-GeneID: 10525
NCBI-ProteinID: NP_001124463
OMIM: 601746
HGNC: 16931
Ensembl: ENSG00000149428
Vega: OTTHUMG00000166354
Pharos: Q9Y4L1(Tbio)
UniProt: Q9Y4L1 A0A384P5T6 B7Z602 B7Z766 Q6IN67 B3KXH0
Position
11q23.3
AA seq 999 aa
MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARF
PEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINTTAQNIMFYDMGSGSTVC
TIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAGLFNEQRKGQRAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFERVP
GPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT
VQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEKENGDK
SEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIGVELVVLDLPDLPEDKLAQSV
QKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSAAST
WLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKV
ETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggcagacaaagttaggaggcagaggccgaggaggcgagtctgttgggccttggtggct
gtgctcttggcagacctgttggcactgagtgatacactggcagtgatgtctgtggacctg
ggcagtgagtccatgaaggtggccattgtcaaacctggagtgcccatggaaattgtcttg
aataaggaatctcggaggaaaacaccggtgatcgtgaccctgaaagaaaatgaaagattc
tttggagacagtgcagcaagcatggcgattaagaatccaaaggctacgctacgttacttc
cagcacctcctggggaagcaggcagataacccccatgtagctctttaccaggcccgcttc
ccggagcacgagctgactttcgacccacagaggcagactgtgcactttcagatcagctcg
cagctgcagttctcacctgaggaagtgttgggcatggttctcaattattctcgttctcta
gctgaagattttgcagagcagcccatcaaggatgcagtgatcaccgtgccagtcttcttc
aaccaggccgagcgccgagctgtgctgcaggctgctcgtatggctggcctcaaagtgctg
cagctcatcaatgacaacaccgccactgccctcagctatggtgtcttccgccggaaagat
attaacaccactgcccagaatatcatgttctatgacatgggctcaggcagcaccgtatgc
accattgtgacctaccagatggtgaagactaaggaagctgggatgcagccacagctgcag
atccggggagtaggatttgaccgtaccctggggggcctggagatggagctccggcttcga
gaacgcctggctgggcttttcaatgagcagcgcaagggtcagagagcaaaggatgtgcgg
gagaacccgcgtgccatggccaagctgctgcgtgaggctaatcggctcaaaaccgtcctc
agtgccaacgctgaccacatggcacagattgaaggcctgatggatgatgtggacttcaag
gcaaaagtgactcgtgtggaatttgaggagttgtgtgcagacttgtttgagcgggtgcct
gggcctgtacagcaggccctccagagtgccgaaatgagtctggatgagattgagcaggtg
atcctggtgggtggggccactcgggtccccagagttcaggaggtgctgctgaaggccgtg
ggcaaggaggagctggggaagaacatcaatgcagatgaagcagccgccatgggggcagtg
taccaggcagctgcgctcagcaaagcctttaaagtgaagccatttgtcgtccgagatgca
gtggtctaccccatcctggtggagttcacgagggaggtggaggaggagcctgggattcac
agcctgaagcacaataaacgggtactcttctctcggatggggccctaccctcaacgcaaa
gtcatcacctttaaccgctacagccatgatttcaacttccacatcaactacggcgacctg
ggcttcctggggcctgaagatcttcgggtatttggctcccagaatctgaccacagtgaag
ctaaaaggggtgggtgacagcttcaagaagtatcctgactacgagtccaagggcatcaag
gctcacttcaacctggatgagagtggcgtgctcagtctagacagggtggagtctgtattt
gagacactggtagaggacagcgcagaagaggaatctactctcaccaaacttggcaacacc
atttccagcctgtttggaggcggtaccacaccagatgccaaggagaatggtactgatact
gtccaggaggaagaggagagccctgcagaggggagcaaggacgagcctggggagcaggtg
gagctcaaggaggaagctgaggccccagtggaggatggctctcagcccccaccccctgaa
cctaagggagatgcaacccctgagggagaaaaggccacagaaaaagaaaatggggacaag
tctgaggcccagaaaccaagtgagaaggcagaggcagggcctgagggcgtcgctccagcc
ccagagggagagaagaagcagaagcccgccaggaagcggcgaatggtagaggagatcggg
gtggagctggttgttctggacctgcctgacttgccagaggataagctggctcagtcggtg
cagaaacttcaggacttgacactccgagacctggagaagcaggaacgggaaaaagctgcc
aacagcttggaagcattcatatttgagacccaggacaagctgtaccagcccgagtaccag
gaagtgtccacagaggagcagcgtgaggagatctctgggaagctcagcgccgcatccacc
tggctggaggatgagggtgttggagccaccacagtgatgttgaaggagaagctggctgag
ctgaggaagctgtgccaagggctgttttttcgggtagaggagcgcaagaagtggcccgaa
cggctgtctgccctcgataatctcctcaaccattccagcatgttcctcaagggggcccgg
ctcatcccagagatggaccagatcttcactgaggtggagatgacaacgttagagaaagtc
atcaatgagacctgggcctggaagaatgcaactctggccgagcaggctaagctgcccgcc
acagagaagcctgtgttgctctcaaaagacattgaagctaagatgatggccctggaccga
gaggtgcagtatctgctcaataaggccaagtttaccaagccccggccccggcctaaggac
aagaatgggacccgggcagagccacccctcaatgccagtgccagtgaccagggggagaag
gtcatccctccagcaggccagactgaagatgcagagcccatttcagaacctgagaaagta
gagactggatccgagccaggagacactgagcctttggagttaggaggtcctggagcagaa
cctgaacagaaagaacaatcgacaggacagaagcggcctttgaagaacgacgaactataa

KEGG   Homo sapiens (human): 64374
Entry
64374             CDS       T01001                                 

Symbol
SIL1, BAP, MSS, ULG5
Name
(RefSeq) SIL1 nucleotide exchange factor
  KO
K14001  nucleotide exchange factor SIL1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01284  Marinesco-Sjogren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64374 (SIL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64374 (SIL1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    64374 (SIL1)
SSDB
Motif
Pfam: Fes1 DUF4704 V-ATPase_H_C
Other DBs
NCBI-GeneID: 64374
NCBI-ProteinID: NP_001032722
OMIM: 608005
HGNC: 24624
Ensembl: ENSG00000120725
Vega: OTTHUMG00000129226
Pharos: Q9H173(Tbio)
UniProt: Q9H173 A0A0S2Z6B4
Position
5q31.2
AA seq 461 aa
MAPQSLPSSRMAPLGMLLGLLMAACFTFCLSHQNLKEFALTNPEKSSTKETERKETKAEE
ELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAKLQYEDKFRNNLKGKRLD
INTNTYTSQDLKSALAKFKEGAEMESSKEDKARQAEVKRLFRPIEELKKDFDELNVVIET
DMQIMVRLINKFNSSSSSLEEKIAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEP
LVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATEQPLTAKKKVLFALCSLLRHF
PYAQRQFLKLGGLQVLRTLVQEKGTEVLAVRVVTLLYDLVTEKMFAEEEAELTQEMSPEK
LQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCRDRYRQDPQLGR
TLASLQAEYQVLASLELQDGEDEGYFQELLGSVNSLLKELR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggctccccagagcctgccttcatctaggatggctcctctgggcatgctgcttgggctg
ctgatggccgcctgcttcaccttctgcctcagtcatcagaacctgaaggagtttgccctg
accaacccagagaagagcagcaccaaagaaacagagagaaaagaaaccaaagccgaggag
gagctggatgccgaagtcctggaggtgttccacccgacgcatgagtggcaggcccttcag
ccagggcaggctgtccctgcaggatcccacgtacggctgaatcttcagactggggaaaga
gaggcaaaactccaatatgaggacaagttccgaaataatttgaaaggcaaaaggctggat
atcaacaccaacacctacacatctcaggatctcaagagtgcactggcaaaattcaaggag
ggggcagagatggagagttcaaaggaagacaaggcaaggcaggctgaggtaaagcggctc
ttccgccccattgaggaactgaagaaagactttgatgagctgaatgttgtcattgagact
gacatgcagatcatggtacggctgatcaacaagttcaatagttccagctccagtttggaa
gagaagattgctgcgctctttgatcttgaatattatgtccatcagatggacaatgcgcag
gacctgctttcctttggtggtcttcaagtggtgatcaatgggctgaacagcacagagccc
ctcgtgaaggagtatgctgcgtttgtgctgggcgctgccttttccagcaaccccaaggtc
caggtggaggccatcgaagggggagccctgcagaagctgctggtcatcctggccacggag
cagccgctcactgcaaagaagaaggtcctgtttgcactgtgctccctgctgcgccacttc
ccctatgcccagcggcagttcctgaagctcggggggctgcaggtcctgaggaccctggtg
caggagaagggcacggaggtgctcgccgtgcgcgtggtcacactgctctacgacctggtc
acggagaagatgttcgccgaggaggaggctgagctgacccaggagatgtccccagagaag
ctgcagcagtatcgccaggtacacctcctgccaggcctgtgggaacagggctggtgcgag
atcacggcccacctcctggcgctgcccgagcatgatgcccgtgagaaggtgctgcagaca
ctgggcgtcctcctgaccacctgccgggaccgctaccgtcaggacccccagctcggcagg
acactggccagcctgcaggctgagtaccaggtgctggccagcctggagctgcaggatggt
gaggacgagggctacttccaggagctgctgggctctgtcaacagcttgctgaaggagctg
agatga

DBGET integrated database retrieval system