KEGG   Homo sapiens (human): 10526Help
Entry
10526             CDS       T01001                                 

Gene name
IPO8, RANBP8
Definition
(RefSeq) importin 8
  KO
K18755  importin-8
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     10526 (IPO8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBN_N Cse1 BUD22 Xpo1 HAND
Motif
Other DBs
NCBI-GeneID: 10526
NCBI-ProteinID: NP_006381
OMIM: 605600
HGNC: 9853
Ensembl: ENSG00000133704
Vega: OTTHUMG00000169172
Pharos: O15397(Tbio)
UniProt: O15397
Position
12p11.21
AA seq 1037 aa AA seqDB search
MDLNRIIQALKGTIDPKLRIAAENELNQSYKIINFAPSLLRIIVSDHVEFPVRQAAAIYL
KNMVTQYWPDREPPPGEAIFPFNIHENDRQQIRDNIVEGIIRSPDLVRVQLTMCLRAIIK
HDFPGHWPGVVDKIDYYLQSQSSASWLGSLLCLYQLVKTYEYKKAEEREPLIIAMQIFLP
RIQQQIVQLLPDSSYYSVLLQKQILKIFYALVQYALPLQLVNNQTMTTWMEIFRTIIDRT
VPPETLHIDEDDRPELVWWKCKKWALHIVARLFERYGSPGNVTKEYFEFSEFFLKTYAVG
IQQVLLKILDQYRQKEYVAPRVLQQAFNYLNQGVVHSITWKQMKPHIQNISEDVIFSVMC
YKDEDEELWQEDPYEYIRMKFDIFEDYASPTTAAQTLLYTAAKKRKEVLPKMMAFCYQIL
TDPNFDPRKKDGALHVIGSLAEILLKKSLFKDQMELFLQNHVFPLLLSNLGYLRARSCWV
LHAFSSLKFHNELNLRNAVELAKKSLIEDKEMPVKVEAALALQSLISNQIQAKEYMKPHV
RPIMQELLHIVRETENDDVTNVIQKMICEYSQEVASIAVDMTQHLAEIFGKVLQSDEYEE
VEDKTVMAMGILHTIDTILTVVEDHKEITQQLENICLRIIDLVLQKHVIEFYEEILSLAY
SLTCHSISPQMWQLLGILYEVFQQDCFEYFTDMMPLLHNYVTIDTDTLLSNAKHLEILFT
MCRKVLCGDAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVQLVLERLTRGVKTSELRT
MCLQVAIAALYYNPDLLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIG
LSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE
ISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQF
FTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFE
NKGVLSAFNFGTVPSNN
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaaccggatcatccaggcgctgaagggcaccatcgacccgaagttgcggatt
gcagccgagaacgagctcaaccagtcctacaagattatcaattttgcccccagtttactt
cggattatagtctctgaccatgtggaattcccagtacgacaggcagctgccatttacctg
aagaacatggtgacacaatactggccagatcgagaacctccaccaggagaagcaatattt
ccattcaacattcacgaaaacgatcgccagcaaatacgtgataacattgtggaaggaata
attcggtctccagatttagtgagagtccaattaacaatgtgtctccgtgccatcataaaa
catgattttcctggtcactggccaggagtggtcgacaagatagactattacttgcaatca
cagagcagtgcaagctggcttggcagtttattatgcctgtatcaactggtgaagacatat
gaatataagaaagcagaagagagagaacctcttataatagcaatgcagatattcctgcct
cgtattcagcaacaaattgttcagctccttcctgattcctcctattattctgtattactg
cagaaacaaattctgaaaatcttttatgcacttgttcagtatgcattgcctcttcagcta
gtgaataaccaaaccatgacaacatggatggagatcttccgaactattatcgacaggacc
gttcctcctgagactctgcacattgatgaggatgatagaccagaactggtatggtggaag
tgtaagaagtgggcactgcatattgtagctcggctctttgaacgatatggaagcccagga
aatgtcacaaaagaatactttgaattttctgaattctttttgaaaacctatgcagtgggc
attcagcaggtgctactaaaaattttagatcaatatagacagaaagaatatgtagctccc
cgtgttcttcagcaagcattcaactatctcaaccaaggggtggttcattctataacctgg
aagcagatgaagccacacatacagaatatctctgaagatgtgattttttctgtgatgtgt
tataaagatgaggatgaagagctgtggcaagaagatccatatgagtatataaggatgaaa
tttgatatttttgaagattatgcttctcccaccacagcagcccagactctcttatatact
gctgcaaagaaaagaaaagaggtgttgccaaaaatgatggcattctgttatcaaatcctg
acagacccgaactttgaccctaggaagaaagatggagccctgcatgtgattggttcccta
gctgagattttactgaagaagagtttattcaaggaccaaatggagctgtttctacaaaat
catgtatttccattattattgtctaacctgggatatcttcgagctagatcttgctgggta
cttcatgcatttagttctttgaagttccataatgagctcaatctaagaaatgccgttgaa
ttagcgaagaagagcctgattgaagataaagagatgcctgtcaaagttgaagctgccctt
gctcttcagtctttaatttctaaccagatacaagctaaggaatatatgaagccacatgtg
aggcctattatgcaggaactgttgcacattgttagagagacagaaaatgatgatgttact
aatgtcatccagaagatgatatgtgaatacagtcaagaggtagcctcaattgctgttgat
atgacccaacacttggctgagatatttggcaaagttcttcaaagtgatgaatatgaagaa
gttgaagacaaaacagtaatggctatgggaattttacataccattgatactatcttaaca
gttgtagaagatcataaagagattacccagcagttagagaatatctgtctacggatcatt
gatcttgttctgcagaaacatgtaattgaattctatgaagaaattctttccctggcatac
agtttaacctgccacagtatttcccctcaaatgtggcagcttctaggtatactatatgaa
gtgtttcagcaggattgctttgaatactttacagacatgatgcctctcctgcataattat
gtgacaatagatacagataccttactatcaaatgcaaaacatttagaaattctttttaca
atgtgtaggaaggtactatgtggagatgcaggagaagatgcagagtgtcatgcagctaaa
cttctggaagtcatcattcttcagtgcaaaggaaggggaattgatcagtgcattccactc
ttcgttcaacttgttttggagagattaactcgaggggtcaaaactagtgagcttcgtact
atgtgtcttcaggttgcaattgctgccttgtactacaaccctgatttgctgctacatact
ttagaacgaattcagttgcctcacaaccctggacctatcactgtacagtttataaatcaa
tggatgaatgatacagattgttttcttgggcatcatgaccggaagatgtgtataatagga
ctgagtatccttttggaattgcaaaatcgacctcctgcagtagatgctgtggtgggacag
attgttccctcaattcttttccttttccttggcctaaagcaggtctgtgctactagacaa
ctggtaaaccgggaagatcgttcaaaagcagagaaagctgatatggaagaaaatgaggag
atttcaagtgatgaagaggagacaaatgtaactgctcaagcaatgcagtcaaataatgga
agaggtgaagatgaggaggaggaagatgatgactgggatgaagaagtattggaagaaacc
gcgcttgaggggttcagtactccacttgaccttgacaatagtgtggatgaatatcagttt
tttacacaagctctgataactgtgcagagtcgagatgcagcctggtaccagctgctgatg
gcaccactcagcgaggatcagaggacagcactgcaggaggtgtacacactggcagagcac
cgacggacggtggcagaggcaaagaagaagattgaacaacagggaggcttcacctttgaa
aacaaaggagtcctctccgcatttaattttgggactgtgcccagcaacaactga

DBGET integrated database retrieval system